Representative Sequence

SPROT Q9ZB17

Aldose 1-epimerase (10064)

1
61
121
181
241
301
MEIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAY PGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQV KFSLVTNDGTNGYPGKIEMSVTHSFDDYNKWKIHYEAISDKDTVFNPTGHVYFNLNGDAS ESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVK GIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGG ITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTK 60
120
180
240
300
339

Domains PDB ID RegionMethodResolution
Representative SP domain (8002389)
Aldose 1-epimerase

Lactococcus lactis (1358)

 Q9ZB17 3-339

Derived from SCOP domain 80724
rasmol icon 1NSZ A:3-339 X-RAY DIFFRACTION 1.75
Clustered domains rasmol icon 1L7J A:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1L7J B:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1L7K A:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1L7K B:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1MMU A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMU B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMX A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMX B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMY A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1MMY B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1MMZ A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMZ B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MN0 A:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1MN0 B:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1NS0 A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS0 B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS2 A:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1NS2 B:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1NS4 A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS4 B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS7 A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS7 B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS8 A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NS8 B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSM A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSM B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSR A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSR B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSS A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSS B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSU A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSU B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSV A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSV B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSX A:3-339 X-RAY DIFFRACTION 1.75
rasmol icon 1NSX B:3-339 X-RAY DIFFRACTION 1.75
rasmol icon 1NSZ B:3-339 X-RAY DIFFRACTION 1.75
Representative PR domain (8002390)
Aldose 1-epimerase

Lactococcus lactis (1358)

 Q9ZB17 3-339

Derived from SCOP domain 80724
rasmol icon 1NSZ A:3-339 X-RAY DIFFRACTION 1.75
Clustered domains rasmol icon 1L7J A:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1L7J B:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1L7K A:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1L7K B:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1MMU A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMU B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMX A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMX B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMY A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1MMY B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1MMZ A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMZ B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MN0 A:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1MN0 B:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1NS0 A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS0 B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS2 A:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1NS2 B:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1NS4 A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS4 B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS7 A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS7 B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS8 A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NS8 B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSM A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSM B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSR A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSR B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSS A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSS B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSU A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSU B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSV A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSV B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSX A:3-339 X-RAY DIFFRACTION 1.75
rasmol icon 1NSX B:3-339 X-RAY DIFFRACTION 1.75
rasmol icon 1NSZ B:3-339 X-RAY DIFFRACTION 1.75
Representative FA domain (8002392)
Aldose 1-epimerase

Lactococcus lactis (1358)

 Q9ZB17 3-339

Derived from SCOP domain 80724
rasmol icon 1NSZ A:3-339 X-RAY DIFFRACTION 1.75
Clustered domains rasmol icon 1L7J A:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1L7J B:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1L7K A:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1L7K B:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1MMU A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMU B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMX A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMX B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMY A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1MMY B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1MMZ A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MMZ B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1MN0 A:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1MN0 B:3-339 X-RAY DIFFRACTION 1.90
rasmol icon 1NS0 A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS0 B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS2 A:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1NS2 B:3-339 X-RAY DIFFRACTION 1.95
rasmol icon 1NS4 A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS4 B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS7 A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS7 B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NS8 A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NS8 B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSM A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSM B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSR A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSR B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSS A:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSS B:3-339 X-RAY DIFFRACTION 1.85
rasmol icon 1NSU A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSU B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSV A:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSV B:3-339 X-RAY DIFFRACTION 1.80
rasmol icon 1NSX A:3-339 X-RAY DIFFRACTION 1.75
rasmol icon 1NSX B:3-339 X-RAY DIFFRACTION 1.75
rasmol icon 1NSZ B:3-339 X-RAY DIFFRACTION 1.75