Representative Sequence

SPROT P03040

Regulatory protein cro (10159)

1
61
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPS NKKTTA 60
66

Domains PDB ID RegionMethodResolution
Representative SP domain (8003961)
Regulatory protein cro
complexed with po4

Escherichia virus Lambda (10710)

 P03040 1-61

Derived from SCOP domain 17044
rasmol icon 5CRO A:1-61 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1COP D:1-61 SOLUTION NMR n/a
rasmol icon 1COP E:1-61 SOLUTION NMR n/a
rasmol icon 1D1L A:1-61 X-RAY DIFFRACTION 2.10
rasmol icon 1D1M A:1-65 The ends of this domain were trimmed X-RAY DIFFRACTION 2.05
rasmol icon 1D1M B:1-65 The ends of this domain were trimmed X-RAY DIFFRACTION 2.05
rasmol icon 1ORC A:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 1.54
rasmol icon 2A63 A:1-61 SOLUTION NMR n/a
rasmol icon 2ECS A:1-60 The ends of this domain were trimmed X-RAY DIFFRACTION 1.400
rasmol icon 2ECS B:1-60 The ends of this domain were trimmed X-RAY DIFFRACTION 1.400
rasmol icon 2ORC A:1-61 SOLUTION NMR n/a
rasmol icon 2OVG A:3-60 The ends of this domain were trimmed X-RAY DIFFRACTION 1.350
rasmol icon 3ORC A:2-66 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 4CRO A:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO B:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO C:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO D:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO E:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO F:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 5CRO B:1-61 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO C:1-61 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO O:1-60 The ends of this domain were trimmed X-RAY DIFFRACTION 2.3
rasmol icon 6CRO A:2-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
Representative PR domain (8003965)
Regulatory protein cro
complexed with po4

Escherichia virus Lambda (10710)

 P03040 1-61

Derived from SCOP domain 17044
rasmol icon 5CRO A:1-61 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1COP D:1-61 SOLUTION NMR n/a
rasmol icon 1COP E:1-61 SOLUTION NMR n/a
rasmol icon 1D1L A:1-61 X-RAY DIFFRACTION 2.10
rasmol icon 1D1M A:1-65 The ends of this domain were trimmed X-RAY DIFFRACTION 2.05
rasmol icon 1D1M B:1-65 The ends of this domain were trimmed X-RAY DIFFRACTION 2.05
rasmol icon 1ORC A:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 1.54
rasmol icon 2A63 A:1-61 SOLUTION NMR n/a
rasmol icon 2ECS A:1-60 The ends of this domain were trimmed X-RAY DIFFRACTION 1.400
rasmol icon 2ECS B:1-60 The ends of this domain were trimmed X-RAY DIFFRACTION 1.400
rasmol icon 2ORC A:1-61 SOLUTION NMR n/a
rasmol icon 2OVG A:3-60 The ends of this domain were trimmed X-RAY DIFFRACTION 1.350
rasmol icon 3ORC A:2-66 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 4CRO A:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO B:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO C:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO D:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO E:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO F:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 5CRO B:1-61 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO C:1-61 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO O:1-60 The ends of this domain were trimmed X-RAY DIFFRACTION 2.3
rasmol icon 6CRO A:2-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
Representative CF domain (8003966)
Regulatory protein cro
complexed with po4

Escherichia virus Lambda (10710)

 P03040 2-57

Derived from SCOP domain 17044
rasmol icon 5CRO A:2-57 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1COP D:2-57 SOLUTION NMR n/a
rasmol icon 1COP E:2-57 SOLUTION NMR n/a
rasmol icon 1D1L A:2-57 X-RAY DIFFRACTION 2.10
rasmol icon 1D1M A:2-62 X-RAY DIFFRACTION 2.05
rasmol icon 1D1M B:2-62 X-RAY DIFFRACTION 2.05
rasmol icon 1ORC A:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 1.54
rasmol icon 2A63 A:2-57 SOLUTION NMR n/a
rasmol icon 2ECS A:2-57 X-RAY DIFFRACTION 1.400
rasmol icon 2ECS B:2-57 X-RAY DIFFRACTION 1.400
rasmol icon 2ORC A:2-57 SOLUTION NMR n/a
rasmol icon 2OVG A:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 1.350
rasmol icon 3ORC A:2-62 X-RAY DIFFRACTION 3.0
rasmol icon 4CRO A:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO B:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO C:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO D:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO E:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO F:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 5CRO B:2-57 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO C:2-57 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO O:2-57 X-RAY DIFFRACTION 2.3
rasmol icon 6CRO A:2-57 X-RAY DIFFRACTION 3.0
Representative FA domain (8003967)
Regulatory protein cro
complexed with po4

Escherichia virus Lambda (10710)

 P03040 1-61

Derived from SCOP domain 17044
rasmol icon 5CRO A:1-61 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1COP D:1-61 SOLUTION NMR n/a
rasmol icon 1COP E:1-61 SOLUTION NMR n/a
rasmol icon 1D1L A:1-61 X-RAY DIFFRACTION 2.10
rasmol icon 1D1M A:1-65 The ends of this domain were trimmed X-RAY DIFFRACTION 2.05
rasmol icon 1D1M B:1-65 The ends of this domain were trimmed X-RAY DIFFRACTION 2.05
rasmol icon 1ORC A:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 1.54
rasmol icon 2A63 A:1-61 SOLUTION NMR n/a
rasmol icon 2ECS A:1-60 The ends of this domain were trimmed X-RAY DIFFRACTION 1.400
rasmol icon 2ECS B:1-60 The ends of this domain were trimmed X-RAY DIFFRACTION 1.400
rasmol icon 2ORC A:1-61 SOLUTION NMR n/a
rasmol icon 2OVG A:3-60 The ends of this domain were trimmed X-RAY DIFFRACTION 1.350
rasmol icon 3ORC A:2-66 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 4CRO A:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO B:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO C:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO D:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO E:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO F:3-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 5CRO B:1-61 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO C:1-61 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO O:1-60 The ends of this domain were trimmed X-RAY DIFFRACTION 2.3
rasmol icon 6CRO A:2-61 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
Representative SF domain (8003968)
Regulatory protein cro
complexed with po4

Escherichia virus Lambda (10710)

 P03040 2-57

Derived from SCOP domain 17044
rasmol icon 5CRO A:2-57 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1COP D:2-57 SOLUTION NMR n/a
rasmol icon 1COP E:2-57 SOLUTION NMR n/a
rasmol icon 1D1L A:2-57 X-RAY DIFFRACTION 2.10
rasmol icon 1D1M A:2-62 X-RAY DIFFRACTION 2.05
rasmol icon 1D1M B:2-62 X-RAY DIFFRACTION 2.05
rasmol icon 1ORC A:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 1.54
rasmol icon 2A63 A:2-57 SOLUTION NMR n/a
rasmol icon 2ECS A:2-57 X-RAY DIFFRACTION 1.400
rasmol icon 2ECS B:2-57 X-RAY DIFFRACTION 1.400
rasmol icon 2ORC A:2-57 SOLUTION NMR n/a
rasmol icon 2OVG A:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 1.350
rasmol icon 3ORC A:2-62 X-RAY DIFFRACTION 3.0
rasmol icon 4CRO A:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO B:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO C:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO D:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO E:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 4CRO F:3-57 The ends of this domain were trimmed X-RAY DIFFRACTION 3.90
rasmol icon 5CRO B:2-57 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO C:2-57 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO O:2-57 X-RAY DIFFRACTION 2.3
rasmol icon 6CRO A:2-57 X-RAY DIFFRACTION 3.0
Representative IR domain (8003970)
Regulatory protein cro
complexed with po4

Escherichia virus Lambda (10710)

 P03040 6-38

Derived from SCOP domain 17044
rasmol icon 5CRO A:6-38 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1COP D:6-38 SOLUTION NMR n/a
rasmol icon 1COP E:6-38 SOLUTION NMR n/a
rasmol icon 1D1L A:6-38 X-RAY DIFFRACTION 2.10
rasmol icon 1D1M A:6-38 X-RAY DIFFRACTION 2.05
rasmol icon 1D1M B:6-38 X-RAY DIFFRACTION 2.05
rasmol icon 1ORC A:6-38 X-RAY DIFFRACTION 1.54
rasmol icon 2A63 A:6-38 SOLUTION NMR n/a
rasmol icon 2ECS A:6-38 X-RAY DIFFRACTION 1.400
rasmol icon 2ECS B:6-38 X-RAY DIFFRACTION 1.400
rasmol icon 2ORC A:6-38 SOLUTION NMR n/a
rasmol icon 2OVG A:6-38 X-RAY DIFFRACTION 1.350
rasmol icon 3ORC A:6-38 X-RAY DIFFRACTION 3.0
rasmol icon 4CRO A:6-38 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO B:6-38 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO C:6-38 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO D:6-38 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO E:6-38 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO F:6-38 X-RAY DIFFRACTION 3.90
rasmol icon 5CRO B:6-38 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO C:6-38 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO O:6-38 X-RAY DIFFRACTION 2.3
rasmol icon 6CRO A:6-38 X-RAY DIFFRACTION 3.0
Representative IR domain (8003971)
Regulatory protein cro
complexed with po4

Escherichia virus Lambda (10710)

 P03040 15-36

Derived from SCOP domain 17044
rasmol icon 5CRO A:15-36 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1COP D:15-36 SOLUTION NMR n/a
rasmol icon 1COP E:15-36 SOLUTION NMR n/a
rasmol icon 1D1L A:15-36 X-RAY DIFFRACTION 2.10
rasmol icon 1D1M A:15-36 X-RAY DIFFRACTION 2.05
rasmol icon 1D1M B:15-36 X-RAY DIFFRACTION 2.05
rasmol icon 1ORC A:15-36 X-RAY DIFFRACTION 1.54
rasmol icon 2A63 A:15-36 SOLUTION NMR n/a
rasmol icon 2ECS A:15-36 X-RAY DIFFRACTION 1.400
rasmol icon 2ECS B:15-36 X-RAY DIFFRACTION 1.400
rasmol icon 2ORC A:15-36 SOLUTION NMR n/a
rasmol icon 2OVG A:15-36 X-RAY DIFFRACTION 1.350
rasmol icon 3ORC A:15-36 X-RAY DIFFRACTION 3.0
rasmol icon 4CRO A:15-36 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO B:15-36 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO C:15-36 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO D:15-36 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO E:15-36 X-RAY DIFFRACTION 3.90
rasmol icon 4CRO F:15-36 X-RAY DIFFRACTION 3.90
rasmol icon 5CRO B:15-36 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO C:15-36 X-RAY DIFFRACTION 2.3
rasmol icon 5CRO O:15-36 X-RAY DIFFRACTION 2.3
rasmol icon 6CRO A:15-36 X-RAY DIFFRACTION 3.0