Representative Sequence

SPROT Q13625

Apoptosis-stimulating of p53 protein 2 (10170)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNE RMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVN SPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLK EIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTR QLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAV MDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMP SRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADL FPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQS SEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSM GTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRK PQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHP ENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEA LRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTAS SESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDN SPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSL PPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGI TALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFA MTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKE GDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1128

Domains PDB ID RegionMethodResolution
Representative PR domain (8004079)
Apoptosis-stimulating of p53 protein 2
complexed with zn

Homo sapiens (9606)

 Q13625 926-1118

Derived from SCOP domain 19155
rasmol icon 1YCS B:327-519 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:926-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:926-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:926-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:926-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:926-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:926-1118 X-RAY DIFFRACTION 2.27
Representative FA domain (8004080)
Apoptosis-stimulating of p53 protein 2
complexed with zn

Homo sapiens (9606)

 Q13625 926-1055

Derived from SCOP domain 19155
rasmol icon 1YCS B:327-456 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:926-1055 X-RAY DIFFRACTION 2.27
Representative SF domain (8004081)
Apoptosis-stimulating of p53 protein 2
complexed with zn

Homo sapiens (9606)

 Q13625 926-1055

Derived from SCOP domain 19155
rasmol icon 1YCS B:327-456 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:926-1055 X-RAY DIFFRACTION 2.27
Representative CF domain (8004082)
Apoptosis-stimulating of p53 protein 2
complexed with zn

Homo sapiens (9606)

 Q13625 926-1055

Derived from SCOP domain 19155
rasmol icon 1YCS B:327-456 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:926-1055 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:926-1055 X-RAY DIFFRACTION 2.27
Representative IR domain (8004083)
Apoptosis-stimulating of p53 protein 2

Homo sapiens (9606)

 Q13625 952-983

Derived from SCOP domain 19155
rasmol icon 1YCS B:353-384 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:952-983 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:952-983 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:952-983 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:952-983 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:952-983 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:952-983 X-RAY DIFFRACTION 2.27
Representative IR domain (8004084)
Apoptosis-stimulating of p53 protein 2

Homo sapiens (9606)

 Q13625 984-1016

Derived from SCOP domain 19155
rasmol icon 1YCS B:385-417 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:984-1016 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:984-1016 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:984-1016 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:984-1016 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:984-1016 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:984-1016 X-RAY DIFFRACTION 2.27
Representative FA domain (8004085)
Apoptosis-stimulating of p53 protein 2

Homo sapiens (9606)

 Q13625 1061-1118

Derived from SCOP domain 24553
rasmol icon 1YCS B:462-519 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:1061-1118 X-RAY DIFFRACTION 2.27
Representative PR domain (8004086)
Apoptosis-stimulating of p53 protein 2
complexed with zn

Homo sapiens (9606)

 Q13625 1-83

rasmol icon 2UWQ A:1-83 SOLUTION NMR n/a
Representative FA domain (8004087)
Apoptosis-stimulating of p53 protein 2
complexed with zn

Homo sapiens (9606)

 Q13625 1-83

rasmol icon 2UWQ A:1-83 SOLUTION NMR n/a
Representative SF domain (8004088)
Apoptosis-stimulating of p53 protein 2
complexed with zn

Homo sapiens (9606)

 Q13625 1-83

rasmol icon 2UWQ A:1-83 SOLUTION NMR n/a
Representative CF domain (8004089)
Apoptosis-stimulating of p53 protein 2
complexed with zn

Homo sapiens (9606)

 Q13625 1-83

rasmol icon 2UWQ A:1-83 SOLUTION NMR n/a
Representative IR domain (8004178)
Apoptosis-stimulating of p53 protein 2

Homo sapiens (9606)

 Q13625 961-982

Derived from SCOP domain 19155
rasmol icon 1YCS B:362-383 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:961-982 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:961-982 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:961-982 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:961-982 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:961-982 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:961-982 X-RAY DIFFRACTION 2.27
Representative IR domain (8004179)
Apoptosis-stimulating of p53 protein 2

Homo sapiens (9606)

 Q13625 994-1015

Derived from SCOP domain 19155
rasmol icon 1YCS B:395-416 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:994-1015 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:994-1015 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:994-1015 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:994-1015 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:994-1015 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:994-1015 X-RAY DIFFRACTION 2.27
Representative IR domain (8004186)
Apoptosis-stimulating of p53 protein 2

Homo sapiens (9606)

 Q13625 928-949

Derived from SCOP domain 19155
rasmol icon 1YCS B:329-350 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:928-949 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:928-949 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:928-949 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:928-949 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:928-949 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:928-949 X-RAY DIFFRACTION 2.27
Representative HF domain (8004409)
Apoptosis-stimulating of p53 protein 2
complexed with zn

Homo sapiens (9606)

 Q13625 1-83

rasmol icon 2UWQ A:1-83 SOLUTION NMR n/a
Representative SF domain (8017713)
Apoptosis-stimulating of p53 protein 2

Homo sapiens (9606)

 Q13625 1061-1118

Derived from SCOP domain 24553
rasmol icon 1YCS B:462-519 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:1061-1118 X-RAY DIFFRACTION 2.27
Representative CF domain (8017714)
Apoptosis-stimulating of p53 protein 2

Homo sapiens (9606)

 Q13625 1061-1118

Derived from SCOP domain 24553
rasmol icon 1YCS B:462-519 X-RAY DIFFRACTION 2.2
Clustered domains rasmol icon 4A63 B:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 D:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 F:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 H:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 J:1061-1118 X-RAY DIFFRACTION 2.27
rasmol icon 4A63 L:1061-1118 X-RAY DIFFRACTION 2.27