Representative Sequence

SPROT P14585

Protein lin-12 (10176)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
MRIPTICFLFLLISLSKSLHIGSCLGLICGRNGHCHAGPVNGTQTSYWCRCDEGFGGEYC EQQCDVSKCGADEKCVFDKDYRMETCVCKDCDINGNSLLKPSCPSGYGGDDCKTQGWCYP SVCMNGGQCIGAGNRAKCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGTYICVC PQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFCDKASSKCQCPPGY HGSTCELLEKEDSCASNPCSHGVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGS KCINGVNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKAFECQCEPGYEGI LCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCM HTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLSGFC VCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDIC ERHKDLCLENPCSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINE EEKGRKCECSYGFSGARCEEKINLTGFTEKDSLLRSVCEKRKCSERANDGNCDADCNYAA CKFDGGDCSGKREPFSKCRYGNMCADFFANGVCNQACNNEECLYDGMDCLPAVVRCPVKI REHCASRFANGICDPECNTNGCGFDGGDCDNETNATIITNIRITVQMDPKEFQVTGGQSL MEISSALRVTVRIQRDEEGPLVFQWNGESEMDRVKMNERQLTEQHVLSTSISRKIKRSAT NIGVVVYLEVQENCDTGKCLYKDAQSVVDSISARLAKKGIDSFGIPISEALVAEPRKSGN NTGFLSWNALLLIGAGCLIVMVVLMLGALPGNRTRKRRMINASVWMPPMENEEKNRKNHQ SITSSQHSLLEASYDGYIKRQRNELQHYSLYPNPQGYGNGNDFLGDFNHTNLQIPTEPEP ESPIKLHTEAAGSYAITEPITRESVNIIDPRHNRTVLHWIASNSSAEKSEDLIVHEAKEC IAAGADVNAMDCDENTPLMLAVLARRRRLVAYLMKAGADPTIYNKSERSALHQAAANRDF GMMVYMLNSTKLKGDIEELDRNGMTALMIVAHNEGRDQVASAKLLVEKGAKVDYDGAARK DSEKYKGRTALHYAAQVSNMPIVKYLVGEKGSNKDKQDEDGKTPIMLAAQEGRIEVVMYL IQQGASVEAVDATDHTARQLAQANNHHNIVDIFDRCRPEREYSMDLHIQHTHQPQPSRKV TRAPKKQTSRSKKESASNSRDSTHLTPPPSDGSTSTPSPQHFMNTTHTTPTSLNYLSPEY QTEAGSSEAFQPQCGAFGNGEMWYTRASTSYTQMQNEPMTRYSEPAHYF 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1260
1320
1380
1429

Domains PDB ID RegionMethodResolution
Representative PR domain (8004160)
Protein lin-12

Caenorhabditis elegans (6239)

 P14585 933-1297

Derived from SCOP domain 145176
rasmol icon 2FO1 E:933-1297 X-RAY DIFFRACTION 3.12
Clustered domains

synthetic construct (32630)

rasmol icon 3BRD D:937-951 The ends of this domain were trimmed X-RAY DIFFRACTION 2.210
rasmol icon 3BRF D:938-950 The ends of this domain were trimmed X-RAY DIFFRACTION 2.470
Representative FA domain (8004161)
Protein lin-12

Caenorhabditis elegans (6239)

 P14585 1021-1297

Derived from SCOP domain 145176
rasmol icon 2FO1 E:1021-1297 X-RAY DIFFRACTION 3.12
Representative FA domain (8004162)
Protein lin-12

Caenorhabditis elegans (6239)

 P14585 933-952

Derived from SCOP domain 145176
rasmol icon 2FO1 E:933-952 X-RAY DIFFRACTION 3.12
Clustered domains

synthetic construct (32630)

rasmol icon 3BRD D:937-951 The ends of this domain were trimmed X-RAY DIFFRACTION 2.210
rasmol icon 3BRF D:938-950 The ends of this domain were trimmed X-RAY DIFFRACTION 2.470
Representative CF domain (8017495)
Protein lin-12

Caenorhabditis elegans (6239)

 P14585 933-952

Derived from SCOP domain 145176
rasmol icon 2FO1 E:933-952 X-RAY DIFFRACTION 3.12
Clustered domains

synthetic construct (32630)

rasmol icon 3BRD D:937-951 The ends of this domain were trimmed X-RAY DIFFRACTION 2.210
rasmol icon 3BRF D:938-950 The ends of this domain were trimmed X-RAY DIFFRACTION 2.470
Representative SF domain (8017551)
Protein lin-12

Caenorhabditis elegans (6239)

 P14585 1021-1297

Derived from SCOP domain 145176
rasmol icon 2FO1 E:1021-1297 X-RAY DIFFRACTION 3.12
Representative CF domain (8017552)
Protein lin-12

Caenorhabditis elegans (6239)

 P14585 1021-1297

Derived from SCOP domain 145176
rasmol icon 2FO1 E:1021-1297 X-RAY DIFFRACTION 3.12