Representative Sequence

SPROT Q7SIG6

Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 (10179)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA INISGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG AEIAEEMEKERRFFQLQMCEYLLKVNEIKVKKGVDLLQNLIKYFHAQCNFFQDGLKAVES LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKESRRDSQLRQSTAYSLHQ PQGNKEHGTERNGNLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVK TNPEEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQ ELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLT LDVLGTSELLLAKNIGNAGFNEIMECCLPSEDPVKPNPGSDMIARKDYITAKYMERRYAR KKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVD RTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETP LDIAKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDVDEKLQPSPNRRE DRPVSFYQLGSSQFQSNAVSLARDTANLTKDKQRGFGPSILQNETYGAILSGSPPSSQSI PPSTTSAPPLPPRNVGKDPLTTTPPPPVAKTSGTLEAMNQPSKSSQPGTSQSKPPPLPPQ PPSRLPQKKPASGTDKPTPLTNKGQPRGPEASGPLSNAMALQPPAPMPRKSQATKSKPKR VKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGEPSRKGAFPVSFVHFIAD 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
958

Domains PDB ID RegionMethodResolution
Representative PR domain (8004090)
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Mus musculus (10090)

 Q7SIG6 422-697

Derived from SCOP domain 19178
rasmol icon 1DCQ A:247-522 X-RAY DIFFRACTION 2.1
Representative FA domain (8004091)
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Mus musculus (10090)

 Q7SIG6 544-683

Derived from SCOP domain 19178
rasmol icon 1DCQ A:369-508 X-RAY DIFFRACTION 2.1
Representative FA domain (8004092)
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Mus musculus (10090)

 Q7SIG6 422-541

Derived from SCOP domain 45326
rasmol icon 1DCQ A:247-366 X-RAY DIFFRACTION 2.1
Representative SF domain (8004093)
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Mus musculus (10090)

 Q7SIG6 435-478

Derived from SCOP domain 45326
rasmol icon 1DCQ A:260-303 X-RAY DIFFRACTION 2.1
Representative CF domain (8004094)
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Mus musculus (10090)

 Q7SIG6 435-471

Derived from SCOP domain 45326
rasmol icon 1DCQ A:260-296 X-RAY DIFFRACTION 2.1
Representative SF domain (8017711)
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Mus musculus (10090)

 Q7SIG6 544-683

Derived from SCOP domain 19178
rasmol icon 1DCQ A:369-508 X-RAY DIFFRACTION 2.1
Representative CF domain (8017712)
Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2

Mus musculus (10090)

 Q7SIG6 544-683

Derived from SCOP domain 19178
rasmol icon 1DCQ A:369-508 X-RAY DIFFRACTION 2.1