Representative Sequence

SPROT Q90623

Protein phosphatase 1 regulatory subunit 12A (10181)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
MKMADAKQKRNEQLKRWIGSETDLEPPVVKRKKTKVKFDDGAVFLAACSSGDTEEVLRLL ERGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLD IAEYLISQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRD ARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQARYDVNIKDYDGWTPLHAAA HWGKEEACRILVENLCDMEAVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKREKKSP LIESTANLDNNQTQKTFKNKETLIMEQEKNASSIESLEHEKADEEEEGKKDESSCSSEEE EDDDSESEAETDKAKTLANANTTSTQSASMTAPSVAGGQGTPTSPLKKFPTSTTKVSPKE EERKDESPASWRLGLRKTGSYGALAEITASKEAQKEKDSAGVIRSASSPRLSSSLDNKEK EKDGKGTRLAYVAPTIPRRLASTSDIDEKENRDSSASSIRSGSSYARRKWEEDVKKNSLN EGPTSLNTSYQRSGSFGRRQDDLVSSNVPSTASTVTSSAGLQKTLPASANTTTKSTTGST SAGVQSSTSNRLWAEDSTEKEKDSVPTAVTVPVAPSVVNAAATTTAMTTATSGTVSSTSE VRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTRE QENEEKEKEEKEKQDKEKQEEKKESETKDDDYRQRYSRTVEEPYHRYRPTSTSTSTSSTS SLSTSTSSLSSSSQLNRPNSLIGITSAYSRSGTKESEREGGKKEEEKEEDKSQPKSIRER RRPREKRRSTGVSFWTQDSDENEQEHQSDSEEGTNKKETQSDSLSRYDTGSLSVSSGDRY DSAQGRSGSQSYLEDRKPYCSRLEKEDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLK LQLEKTTQRQERFADRSLLEMEKRVSGKSQYLLGGKKSSRKKDI 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1004

Domains PDB ID RegionMethodResolution
Representative PR domain (8004118)
Protein phosphatase 1 regulatory subunit 12A
complexed with mn, pge, mutant

Gallus gallus (9031)

 Q90623 1-291

Derived from SCOP domain 105317
rasmol icon 1S70 B:1-291 X-RAY DIFFRACTION 2.70
Representative FA domain (8004119)
Protein phosphatase 1 regulatory subunit 12A
complexed with mn, pge, mutant

Gallus gallus (9031)

 Q90623 38-164

Derived from SCOP domain 105317
rasmol icon 1S70 B:38-164 X-RAY DIFFRACTION 2.70
Representative FA domain (8004120)
Protein phosphatase 1 regulatory subunit 12A
complexed with mn, pge, mutant

Gallus gallus (9031)

 Q90623 190-291

Derived from SCOP domain 105317
rasmol icon 1S70 B:190-291 X-RAY DIFFRACTION 2.70