Representative Sequence

SPROT P15924

Desmoplakin (10183)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
1441
1501
1561
1621
1681
1741
1801
1861
1921
1981
2041
2101
2161
2221
2281
2341
2401
2461
2521
2581
2641
2701
2761
2821
MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTG TMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEI LDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGW DEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKA DLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD KNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSW ILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKE LEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGD ECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQL YINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMF GDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVNHNKVIETNRE NDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIA EVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQT EDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHS QTSQQYPLYDLDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCK WLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANSIKD YELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEM LKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLASLE ELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYD QLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYN EEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSI LQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAAKTI QDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTIHQL TMQKEEDTSGYRAQIDNLTRENRSLSEEIKRLKNTLTQTTENLRRVEEDIQQQKATGSEV SQRKQQLEVELRQVTQMRTEESVRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCL EDENARLQRVQYDLQKANSSATETINKLKVQEQELTRLRIDYERVSQERTVKDQDITRFQ NSLKELQLQKQKVEEELNRLKRTASEDSCKRKKLEEELEGMRRSLKEQAIKITNLTQQLE QASIVKKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQAHL RNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSE ADSDKNATILELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQE SKNQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKSTLEAETRVKQRLECEKQQI QNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDS TRETQSQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTAMQL YECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGSIAGASASPKEKYSLVEAKRKKLI SPESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAEKAITGFDDPF SGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYR SLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPVTVT ELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMKI GLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYN DPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEE LSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQVQTSQKNT LRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLV DRKTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGTSSSMGSGVSDD VFSSSRHESVSKISTISSVRNLTIRSSSFSDTLEESSPIAAIFDTENLEKISITEGIERG IVDSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAFIGFEG VKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRA AQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMS SAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1260
1320
1380
1440
1500
1560
1620
1680
1740
1800
1860
1920
1980
2040
2100
2160
2220
2280
2340
2400
2460
2520
2580
2640
2700
2760
2820
2871

Domains PDB ID RegionMethodResolution
Representative PR domain (8004055)
Desmoplakin
domain C

Homo sapiens (9606)

 P15924 2613-2808

Derived from SCOP domain 74030
rasmol icon 1LM5 B:2613-2808 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 1LM5 A:2616-2808 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
Representative FA domain (8004056)
Desmoplakin
domain C

Homo sapiens (9606)

 P15924 2613-2808

Derived from SCOP domain 74030
rasmol icon 1LM5 B:2613-2808 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 1LM5 A:2616-2808 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
Representative SF domain (8004058)
Desmoplakin
domain C

Homo sapiens (9606)

 P15924 2613-2808

Derived from SCOP domain 74030
rasmol icon 1LM5 B:2613-2808 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 1LM5 A:2616-2808 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
Representative CF domain (8004059)
Desmoplakin
domain C

Homo sapiens (9606)

 P15924 2613-2808

Derived from SCOP domain 74030
rasmol icon 1LM5 B:2613-2808 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 1LM5 A:2616-2808 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
Representative IR domain (8004060)
Desmoplakin
repeat 1 in domain C

Homo sapiens (9606)

 P15924 2621-2658

Derived from SCOP domain 74030
rasmol icon 1LM5 B:2621-2658 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 1LM5 A:2621-2658 X-RAY DIFFRACTION 1.80
Representative IR domain (8004061)
Desmoplakin
repeat 2 in domain C

Homo sapiens (9606)

 P15924 2659-2697

Derived from SCOP domain 74030
rasmol icon 1LM5 B:2659-2697 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 1LM5 A:2659-2697 X-RAY DIFFRACTION 1.80
Representative IR domain (8004062)
Desmoplakin
repeat 3 in domain C

Homo sapiens (9606)

 P15924 2698-2734

Derived from SCOP domain 74030
rasmol icon 1LM5 B:2698-2734 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 1LM5 A:2698-2734 X-RAY DIFFRACTION 1.80
Representative IR domain (8004063)
Desmoplakin
repeat 4 in domain C

Homo sapiens (9606)

 P15924 2735-2767

Derived from SCOP domain 74030
rasmol icon 1LM5 B:2735-2767 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 1LM5 A:2735-2767 X-RAY DIFFRACTION 1.80
Representative PR domain (8004066)
Desmoplakin
domain B (residues 2209-2456)

Homo sapiens (9606)

 P15924 2209-2448

Derived from SCOP domain 74031
rasmol icon 1LM7 A:2209-2448 X-RAY DIFFRACTION 3.00
Clustered domains rasmol icon 1LM7 B:2209-2448 X-RAY DIFFRACTION 3.00
rasmol icon 5DZZ A:2209-2448 X-RAY DIFFRACTION 2.6000
Representative FA domain (8004067)
Desmoplakin
domain B

Homo sapiens (9606)

 P15924 2256-2448

Derived from SCOP domain 74031
rasmol icon 1LM7 A:2256-2448 X-RAY DIFFRACTION 3.00
Clustered domains rasmol icon 1LM7 B:2256-2448 X-RAY DIFFRACTION 3.00
rasmol icon 5DZZ A:2256-2448 X-RAY DIFFRACTION 2.6000
Representative IR domain (8004068)
Desmoplakin
extra N-terminal repeat in domain B

Homo sapiens (9606)

 P15924 2209-2255

Derived from SCOP domain 74031
rasmol icon 1LM7 A:2209-2255 X-RAY DIFFRACTION 3.00
Clustered domains rasmol icon 1LM7 B:2209-2255 X-RAY DIFFRACTION 3.00
rasmol icon 5DZZ A:2209-2255 X-RAY DIFFRACTION 2.6000
Representative PR domain (8004069)
Desmoplakin
a rigid four spectrin repeat fragment, also contains SH3 domain

Homo sapiens (9606)

 P15924 178-627

rasmol icon 3R6N A:178-627 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:179-625 The ends of this domain were trimmed X-RAY DIFFRACTION 2.9500
Representative FA domain (8004070)
Desmoplakin

Homo sapiens (9606)

 P15924 178-270

rasmol icon 3R6N A:178-270 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:179-270 The ends of this domain were trimmed X-RAY DIFFRACTION 2.9500
Representative FA domain (8004071)
Desmoplakin

Homo sapiens (9606)

 P15924 271-373

rasmol icon 3R6N A:271-373 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:271-373 X-RAY DIFFRACTION 2.9500
Representative FA domain (8004072)
Desmoplakin

Homo sapiens (9606)

 P15924 374-446,514-545

rasmol icon 3R6N A:374-446,514-545 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:374-446,514-545 X-RAY DIFFRACTION 2.9500
Representative FA domain (8004073)
Desmoplakin

Homo sapiens (9606)

 P15924 546-627

rasmol icon 3R6N A:546-627 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:546-625 The ends of this domain were trimmed X-RAY DIFFRACTION 2.9500
Representative SF domain (8004074)
Desmoplakin

Homo sapiens (9606)

 P15924 271-373

rasmol icon 3R6N A:271-373 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:271-373 X-RAY DIFFRACTION 2.9500
Representative CF domain (8004075)
Desmoplakin

Homo sapiens (9606)

 P15924 271-373

rasmol icon 3R6N A:271-373 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:271-373 X-RAY DIFFRACTION 2.9500
Representative FA domain (8004076)
Desmoplakin
inserted in one of the spectrin repeat family domain

Homo sapiens (9606)

 P15924 460-513

rasmol icon 3R6N A:460-513 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:460-513 X-RAY DIFFRACTION 2.9500
Representative SF domain (8004077)
Desmoplakin
inserted in one of the spectrin repeat family domain

Homo sapiens (9606)

 P15924 460-513

rasmol icon 3R6N A:460-513 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:460-513 X-RAY DIFFRACTION 2.9500
Representative CF domain (8004078)
Desmoplakin
inserted in one of the spectrin repeat family domain

Homo sapiens (9606)

 P15924 460-513

rasmol icon 3R6N A:460-513 X-RAY DIFFRACTION 2.9500
Clustered domains rasmol icon 3R6N B:460-513 X-RAY DIFFRACTION 2.9500