Representative Sequence

SPROT O22265

Signal recognition particle 43 kDa protein, chloroplastic (10188)

1
61
121
181
241
301
361
MQKVFLAMDTCALVIHQSLSRIKLSPPKSSSSSSSAFSPESLPIRRIELCFRGAICAAVQ RNYEETTSSVEEAEEDDESSSSYGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYI AADVVSEYETPWWTAARKADEQALSQLLEDRDVDAVDENGRTALLFVAGLGSDKCVRLLA EAGADLDHRDMRGGLTALHMAAGYVRPEVVEALVELGADIEVEDERGLTALELAREILKT TPKGNPMQFGRRIGLEKVINVLEGQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWV KGVHVAEDVAKDYEDGLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDST LVLLYQQQQPMNE 60
120
180
240
300
360
373

Domains PDB ID RegionMethodResolution
Representative PR domain (8004139)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 85-318

rasmol icon 3UI2 A:85-318 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 1X32 A:4-47 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 1X3Q A:3-56 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 2HUG A:3-56 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 3DEO A:85-267 The ends of this domain were trimmed X-RAY DIFFRACTION 1.500
rasmol icon 3DEP A:85-267 The ends of this domain were trimmed X-RAY DIFFRACTION 2.700
rasmol icon 5E4W C:265-318 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8000
rasmol icon 5E4W D:265-318 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8000
Representative FA domain (8004140)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 85-128

rasmol icon 3UI2 A:85-128 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 1X32 A:4-47 SOLUTION NMR n/a
rasmol icon 3DEO A:85-128 X-RAY DIFFRACTION 1.500
rasmol icon 3DEP A:85-128 X-RAY DIFFRACTION 2.700
Representative FA domain (8004141)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 267-318

rasmol icon 3UI2 A:267-318 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 1X3Q A:5-56 SOLUTION NMR n/a
rasmol icon 2HUG A:5-56 SOLUTION NMR n/a
rasmol icon 5E4W C:267-318 X-RAY DIFFRACTION 2.8000
rasmol icon 5E4W D:267-318 X-RAY DIFFRACTION 2.8000
Representative SF domain (8004142)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 267-305

rasmol icon 3UI2 A:267-305 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 1X3Q A:5-43 SOLUTION NMR n/a
rasmol icon 2HUG A:5-43 SOLUTION NMR n/a
rasmol icon 5E4W C:267-305 X-RAY DIFFRACTION 2.8000
rasmol icon 5E4W D:267-305 X-RAY DIFFRACTION 2.8000
Representative CF domain (8004143)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 267-318

rasmol icon 3UI2 A:267-318 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 1X3Q A:5-56 SOLUTION NMR n/a
rasmol icon 2HUG A:5-56 SOLUTION NMR n/a
rasmol icon 5E4W C:267-318 X-RAY DIFFRACTION 2.8000
rasmol icon 5E4W D:267-318 X-RAY DIFFRACTION 2.8000
Representative FA domain (8004144)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 129-266

rasmol icon 3UI2 A:129-266 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 3DEO A:129-266 X-RAY DIFFRACTION 1.500
rasmol icon 3DEP A:129-266 X-RAY DIFFRACTION 2.700
Representative PR domain (8004146)
Signal recognition particle 43 kDa protein, chloroplastic
low-resolution NMR structure

Arabidopsis thaliana (3702)

 O22265 320-373

Derived from SCOP domain 121668
rasmol icon 1X3P A:1-54 SOLUTION NMR n/a
Clustered domains rasmol icon 2N88 A:53-106 SOLUTION NMR n/a
rasmol icon 5E4W C:320-369 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8000
rasmol icon 5E4W D:320-369 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8000
rasmol icon 5E4X A:320-368 The ends of this domain were trimmed X-RAY DIFFRACTION 2.75
Representative FA domain (8004147)
Signal recognition particle 43 kDa protein, chloroplastic
low-resolution NMR structure

Arabidopsis thaliana (3702)

 O22265 320-373

Derived from SCOP domain 121668
rasmol icon 1X3P A:1-54 SOLUTION NMR n/a
Clustered domains rasmol icon 2N88 A:53-106 SOLUTION NMR n/a
rasmol icon 5E4W C:320-369 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8000
rasmol icon 5E4W D:320-369 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8000
rasmol icon 5E4X A:320-368 The ends of this domain were trimmed X-RAY DIFFRACTION 2.75
Representative SF domain (8017707)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 129-266

rasmol icon 3UI2 A:129-266 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 3DEO A:129-266 X-RAY DIFFRACTION 1.500
rasmol icon 3DEP A:129-266 X-RAY DIFFRACTION 2.700
Representative CF domain (8017708)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 129-266

rasmol icon 3UI2 A:129-266 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 3DEO A:129-266 X-RAY DIFFRACTION 1.500
rasmol icon 3DEP A:129-266 X-RAY DIFFRACTION 2.700
Representative CF domain (8017709)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 85-128

rasmol icon 3UI2 A:85-128 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 1X32 A:4-47 SOLUTION NMR n/a
rasmol icon 3DEO A:85-128 X-RAY DIFFRACTION 1.500
rasmol icon 3DEP A:85-128 X-RAY DIFFRACTION 2.700
Representative SF domain (8017710)
Signal recognition particle 43 kDa protein, chloroplastic

Arabidopsis thaliana (3702)

 O22265 85-120

rasmol icon 3UI2 A:85-120 X-RAY DIFFRACTION 3.178
Clustered domains rasmol icon 1X32 A:4-39 SOLUTION NMR n/a
rasmol icon 3DEO A:85-120 X-RAY DIFFRACTION 1.500
rasmol icon 3DEP A:85-120 X-RAY DIFFRACTION 2.700