Representative Sequence

SPROT Q99728

BRCA1-associated RING domain protein 1 (10189)

1
61
121
181
241
301
361
421
481
541
601
661
721
MPDNRQPRNRQPRIRSGNEPRSAPAMEPDGRGAWAHSRAALDRLEKLLRCSRCTNILREP VCLGGCEHIFCSNCVSDCIGTGCPVCYTPAWIQDLKINRQLDSMIQLCSKLRNLLHDNEL SDLKEDKPRKSLFNDAGNKKNSIKMWFSPRSKKVRYVVSKASVQTQPAIKKDASAQQDSY EFVSPSPPADVSERAKKASARSGKKQKKKTLAEINQKWNLEAEKEDGEFDSKEESKQKLV SFCSQPSVISSPQINGEIDLLASGSLTESECFGSLTEVSLPLAEQIESPDTKSRNEVVTP EKVCKNYLTSKKSLPLENNGKRGHHNRLSSPISKRCRTSILSTSGDFVKQTVPSENIPLP ECSSPPSCKRKVGGTSGRKNSNMSDEFISLSPGTPPSTLSSSSYRRVMSSPSAMKLLPNM AVKRNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELL LQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMK SLLLLPEKNESSSASHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAVILKAKKYTEF DSTVTHVVVPGDAVQSTLKCMLGILNGCWILKFEWVKACLRRKVCEQEEKYEIPEGPRRS RLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTV AYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWKAPSSWFIDCVMSFELLPLDS 60
120
180
240
300
360
420
480
540
600
660
720
777

Domains PDB ID RegionMethodResolution
Representative PR domain (8004127)
BRCA1-associated RING domain protein 1

Homo sapiens (9606)

 Q99728 425-546

Derived from SCOP domain 155949
rasmol icon 3C5R A:425-546 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3C5R B:425-545 The ends of this domain were trimmed X-RAY DIFFRACTION 2.00
Representative FA domain (8004128)
BRCA1-associated RING domain protein 1

Homo sapiens (9606)

 Q99728 425-546

Derived from SCOP domain 155949
rasmol icon 3C5R A:425-546 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3C5R B:425-545 The ends of this domain were trimmed X-RAY DIFFRACTION 2.00
Representative PR domain (8004129)
BRCA1-associated RING domain protein 1

Homo sapiens (9606)

 Q99728 568-777

rasmol icon 2NTE A:568-777 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 2NTE B:569-777 The ends of this domain were trimmed X-RAY DIFFRACTION 1.90
rasmol icon 2R1Z A:569-777 The ends of this domain were trimmed X-RAY DIFFRACTION 2.100
rasmol icon 2R1Z B:569-776 The ends of this domain were trimmed X-RAY DIFFRACTION 2.100
rasmol icon 3FA2 A:568-775 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3FA2 B:568-775 Some residues were not observed X-RAY DIFFRACTION 2.20
Representative FA domain (8004130)
BRCA1-associated RING domain protein 1

Homo sapiens (9606)

 Q99728 568-644

rasmol icon 2NTE A:568-644 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 2NTE B:569-644 The ends of this domain were trimmed X-RAY DIFFRACTION 1.90
rasmol icon 2R1Z A:569-644 The ends of this domain were trimmed X-RAY DIFFRACTION 2.100
rasmol icon 2R1Z B:569-644 The ends of this domain were trimmed X-RAY DIFFRACTION 2.100
rasmol icon 3FA2 A:568-644 X-RAY DIFFRACTION 2.20
rasmol icon 3FA2 B:568-644 X-RAY DIFFRACTION 2.20
Representative FA domain (8004131)
BRCA1-associated RING domain protein 1

Homo sapiens (9606)

 Q99728 672-771

rasmol icon 2NTE A:672-771 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 2NTE B:672-771 X-RAY DIFFRACTION 1.90
rasmol icon 2R1Z A:672-771 X-RAY DIFFRACTION 2.100
rasmol icon 2R1Z B:672-771 X-RAY DIFFRACTION 2.100
rasmol icon 3FA2 A:672-771 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3FA2 B:672-771 Some residues were not observed X-RAY DIFFRACTION 2.20
Representative SF domain (8004132)
BRCA1-associated RING domain protein 1

Homo sapiens (9606)

 Q99728 568-644

rasmol icon 2NTE A:568-644 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 2NTE B:569-644 The ends of this domain were trimmed X-RAY DIFFRACTION 1.90
rasmol icon 2R1Z A:569-644 The ends of this domain were trimmed X-RAY DIFFRACTION 2.100
rasmol icon 2R1Z B:569-644 The ends of this domain were trimmed X-RAY DIFFRACTION 2.100
rasmol icon 3FA2 A:568-644 X-RAY DIFFRACTION 2.20
rasmol icon 3FA2 B:568-644 X-RAY DIFFRACTION 2.20
Representative CF domain (8004133)
BRCA1-associated RING domain protein 1

Homo sapiens (9606)

 Q99728 568-644

rasmol icon 2NTE A:568-644 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 2NTE B:569-644 The ends of this domain were trimmed X-RAY DIFFRACTION 1.90
rasmol icon 2R1Z A:569-644 The ends of this domain were trimmed X-RAY DIFFRACTION 2.100
rasmol icon 2R1Z B:569-644 The ends of this domain were trimmed X-RAY DIFFRACTION 2.100
rasmol icon 3FA2 A:568-644 X-RAY DIFFRACTION 2.20
rasmol icon 3FA2 B:568-644 X-RAY DIFFRACTION 2.20
Representative PR domain (8004134)
BRCA1-associated RING domain protein 1
heterodimer with brca1 RING domain; complexed with zn

Homo sapiens (9606)

 Q99728 26-122

Derived from SCOP domain 66881
rasmol icon 1JM7 B:26-122 SOLUTION NMR n/a
Representative FA domain (8004135)
BRCA1-associated RING domain protein 1
heterodimer with brca1 RING domain; complexed with zn

Homo sapiens (9606)

 Q99728 48-98

Derived from SCOP domain 66881
rasmol icon 1JM7 B:48-98 SOLUTION NMR n/a
Representative SF domain (8004136)
BRCA1-associated RING domain protein 1
heterodimer with brca1 RING domain; complexed with zn

Homo sapiens (9606)

 Q99728 48-98

Derived from SCOP domain 66881
rasmol icon 1JM7 B:48-98 SOLUTION NMR n/a
Representative CF domain (8004137)
BRCA1-associated RING domain protein 1
heterodimer with brca1 RING domain; complexed with zn

Homo sapiens (9606)

 Q99728 48-80

Derived from SCOP domain 66881
rasmol icon 1JM7 B:48-80 SOLUTION NMR n/a