Representative Sequence

SPROT Q61193

Ral guanine nucleotide dissociation stimulator-like 2 (10368)

1
61
121
181
241
301
361
421
481
541
601
661
721
MLPRPLRLLLDTTPPGGVVLSSFRSRDPEEGGDPGGRAVGGGQEEEDEEEEEASVSVWDE EEDGATFTVTSRQYRPLDPLAPLPPPRSSRRLRAGTLEALVRHLLDARTAGADMMFTPAL LATHRAFTSTPALFGLVADRLEALESHPPGELERTTGVAISVLSTWLASHPEDFGSEVKG QLDRLESFLLRTGYAAREGVVGGSADLIRNLRARVDPRAPDLPKPLALPGDSPADPTDVL VFLADHLAEQLTLLDAELFLNLIPSQCLGGLWGHRDRPGHSHLCPSVRATVTQFNKVAGA VVSSVLGATSIGEGPREVTVRPLRPPQRARLLEKWIRVAEECRLLRNFSSVYAVVSALQS SPIHRLRAAWGETTRDSLRVFSSLCQIFSEEDNYSQSRELLMQEVKPQPPVEPHSKKAPR SGFRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAILSELLRLQKECRGY DLRPNSDIQQWLQGLQPLTEAQSHRVSCEVEPPGTSDSPAARTPRPTLVITQWTEVLGSV GGPTPLVSWDRPSVGGDEVPGTPAPLLTRLAQHMKWPSVSSLDSALESSPSLHSPADPGH LSPPASSPRPSRGHRRSASCGSPLSGNTGEGTSRSAGCGGGVSGPGSSDCRIIRVQMELG EDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEFELVQLLPGDRELTIPHSANVFY AMDGASHDFLLRQRRRPSAATPGSHSGPSASGTPPSEGGGGSFPRIKATGRKIARALF 60
120
180
240
300
360
420
480
540
600
660
720
778

Domains PDB ID RegionMethodResolution
Representative PR domain (8018953)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 646-735

Derived from SCOP domain 37628
rasmol icon 1RLF A:646-735 SOLUTION NMR n/a
Representative PR domain (8018954)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 50-512

rasmol icon 4JGW A:50-512 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 4JGW B:53-512 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 5CM8 A:54-512 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 A:54-512 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 B:53-512 Some residues were not observed X-RAY DIFFRACTION 2.60
Representative FA domain (8018955)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 243-512

rasmol icon 4JGW A:243-512 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 4JGW B:243-512 X-RAY DIFFRACTION 2.30
rasmol icon 5CM8 A:243-512 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 A:243-512 X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 B:243-512 X-RAY DIFFRACTION 2.60
Representative FA domain (8018956)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 648-735

Derived from SCOP domain 37628
rasmol icon 1RLF A:648-735 SOLUTION NMR n/a
Representative SF domain (8018958)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 648-735

Derived from SCOP domain 37628
rasmol icon 1RLF A:648-735 SOLUTION NMR n/a
Representative HF domain (8018959)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 648-735

Derived from SCOP domain 37628
rasmol icon 1RLF A:648-735 SOLUTION NMR n/a
Representative CF domain (8018960)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 648-735

Derived from SCOP domain 37628
rasmol icon 1RLF A:648-735 SOLUTION NMR n/a
Representative FA domain (8018961)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 96-212

rasmol icon 4JGW A:96-212 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 4JGW B:96-212 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 5CM8 A:96-212 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 A:96-212 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 B:96-212 Some residues were not observed X-RAY DIFFRACTION 2.60
Representative SF domain (8018962)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 96-212

rasmol icon 4JGW A:96-212 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 4JGW B:96-212 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 5CM8 A:96-212 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 A:96-212 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 B:96-212 Some residues were not observed X-RAY DIFFRACTION 2.60
Representative CF domain (8018963)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 96-212

rasmol icon 4JGW A:96-212 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 4JGW B:96-212 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 5CM8 A:96-212 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 A:96-212 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 B:96-212 Some residues were not observed X-RAY DIFFRACTION 2.60
Representative CF domain (8018964)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 243-388

rasmol icon 4JGW A:243-388 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 4JGW B:243-388 X-RAY DIFFRACTION 2.30
rasmol icon 5CM8 A:243-388 X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 A:243-388 X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 B:243-388 X-RAY DIFFRACTION 2.60
Representative SF domain (8018965)
Ral guanine nucleotide dissociation stimulator-like 2

Mus musculus (10090)

 Q61193 243-512

rasmol icon 4JGW A:243-512 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 4JGW B:243-512 X-RAY DIFFRACTION 2.30
rasmol icon 5CM8 A:243-512 Some residues were not observed X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 A:243-512 X-RAY DIFFRACTION 2.60
rasmol icon 5CM9 B:243-512 X-RAY DIFFRACTION 2.60