Representative Sequence

SPROT Q62696

Disks large homolog 1 (11622)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTL LDNPKCVDHSKQCEPVQPGNPWESGSLSSAAVTSESLPGGLSPPVEKYRYQDEEVLPSER ISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIKPTEAVPPSSPIVPVTPALP VPAESPVVLPSTPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAG GTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAG SIVRLYVKRRKAFRKNHEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHK DGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKAAKPTSMYINDGYAPPDITN SSSQSVDNHVSPSSYLGQTPASPARYSPISKAVLGDDEITREPRKVVLHRGSTGLGFNIV GGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI VAQYRPEEYSRFEAKIHDLRETMMNSSVSSGSGSLRTSQKRSLYVRALFDYDKTKDSGLP SQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFN SKTRGDKGEIPDDMGSKGLKHVTSNASDSESSYHEYGCSKGGQEEYVLSYEPVNQQEVNY TRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDI QEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPK SMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSG PYIWVPAKEKL 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
911

Domains PDB ID RegionMethodResolution
Representative PR domain (8019114)
Disks large homolog 1

Rattus norvegicus (10116)

 Q62696 582-908

rasmol icon 3UAT A:582-908 X-RAY DIFFRACTION 2.700
Representative FA domain (8019115)
Disks large homolog 1

Rattus norvegicus (10116)

 Q62696 719-900

rasmol icon 3UAT A:719-900 X-RAY DIFFRACTION 2.700
Representative FA domain (8019116)
Disks large homolog 1

Rattus norvegicus (10116)

 Q62696 582-646

rasmol icon 3UAT A:582-646 X-RAY DIFFRACTION 2.700