Representative Sequence

SPROT P27870

Proto-oncogene vav (12188)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPQAINLREV NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI AQNKGIMPFPTEDSALNDEDIYSGLSDQIDDTAEEDEDLYDCVENEEAEGDEIYEDLMRL ESVPTPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDMETIFVNI EELFSVHTHFLKELKDALAGPGATTLYQVFIKYKERFLVYGRYCSQVESASKHLDQVATA REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDATEKENLRLAL DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLANYGRPKIDGELKITSVERRSKT DRYAFLLDKALLICKRRGDSYDLKASVNLHSFQVRDDSSGERDNKKWSHMFLLIEDQGAQ GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF YQGYRCYRCRAPAHKECLGRVPPCGRHGQDFAGTMKKDKLHRRAQDKKRNELGLPKMEVF QEYYGIPPPPGAFGPFLRLNPGDIVELTKAEAEHNWWEGRNTATNEVGWFPCNRVHPYVH GPPQDLSVHLWYAGPMERAGAEGILTNRSDGTYLVRQRVKDTAEFAISIKYNVEVKHIKI MTSEGLYRITEKKAFRGLLELVEFYQQNSLKDCFKSLDTTLQFPYKEPERRAISKPPAGS TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRIGWFPSNYVEED YSEYC 60
120
180
240
300
360
420
480
540
600
660
720
780
840
845

Domains PDB ID RegionMethodResolution
Representative PR domain (8018847)
Proto-oncogene vav
autoinhibited

Mus musculus (10090)

 P27870 190-564

rasmol icon 2VRW B:190-564 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1F5X A:23-208 The ends of this domain were trimmed SOLUTION NMR n/a
Representative FA domain (8018848)
Proto-oncogene vav
autoinhibited

Mus musculus (10090)

 P27870 190-375

rasmol icon 2VRW B:190-375 X-RAY DIFFRACTION 1.85
Clustered domains rasmol icon 1F5X A:23-208 SOLUTION NMR n/a
Representative PR domain (8018849)
Proto-oncogene vav

Mus musculus (10090)

 P27870 595-659

Derived from SCOP domain 60434
rasmol icon 1GCQ C:595-659 X-RAY DIFFRACTION 1.68
Clustered domains rasmol icon 1GCP A:596-659 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 1GCP B:595-659 X-RAY DIFFRACTION 2.1
rasmol icon 1GCP C:596-659 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 1GCP D:596-659 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 1K1Z A:13-77 SOLUTION NMR n/a
Representative FA domain (8018850)
Proto-oncogene vav

Mus musculus (10090)

 P27870 595-659

Derived from SCOP domain 60434
rasmol icon 1GCQ C:595-659 X-RAY DIFFRACTION 1.68
Clustered domains rasmol icon 1GCP A:596-659 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 1GCP B:595-659 X-RAY DIFFRACTION 2.1
rasmol icon 1GCP C:596-659 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 1GCP D:596-659 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 1K1Z A:13-77 SOLUTION NMR n/a
Representative FA domain (8018852)
Proto-oncogene vav
autoinhibited

Mus musculus (10090)

 P27870 403-508

rasmol icon 2VRW B:403-508 X-RAY DIFFRACTION 1.85
Representative FA domain (8018853)
Proto-oncogene vav
autoinhibited

Mus musculus (10090)

 P27870 512-564

rasmol icon 2VRW B:512-564 X-RAY DIFFRACTION 1.85