Representative Sequence

SPROT P03692

DNA primase/helicase (12454)

1
61
121
181
241
301
361
421
481
541
MDNSHDSDSVFLYHIPCDNCGSSDGNSLFSDGHTFCYVCEKWTAGNEDTKERASKRKPSG GKPMTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVS QKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGH GASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANE CHLNGHDREIMEQVWNAGPWIPDGVVSALSLRERIREHLSSEESVGLLFSGCTGINDKTL GARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRV RLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDV IILDHISIVVSASGESDERKMIDNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRP VSITDLRGSGALRQLSDTIIALERNQQGDMPNLVLVRILKCRFTGDTGIAGYMEYNKETG WLEPSSYSGEEESHSESTDWSNDTDF 60
120
180
240
300
360
420
480
540
566

Domains PDB ID RegionMethodResolution
Representative PR domain (8018192)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 271-547

Derived from SCOP domain 32286
rasmol icon 1CR1 A:271-547 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1CR0 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR2 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR4 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.50
rasmol icon 1E0J A:271-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J B:271-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J C:271-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J D:271-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J E:271-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J F:271-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0K A:271-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K B:271-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K C:271-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K D:271-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K E:271-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K F:271-547 X-RAY DIFFRACTION 3.30
rasmol icon 1Q57 A:271-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 B:271-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:271-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:271-547 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:271-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:271-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:271-547 Some residues were not observed X-RAY DIFFRACTION 3.45
Representative FA domain (8018193)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 283-547

Derived from SCOP domain 32286
rasmol icon 1CR1 A:283-547 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1CR0 A:283-547 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR2 A:283-547 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR4 A:283-547 Some residues were not observed X-RAY DIFFRACTION 2.50
rasmol icon 1E0J A:283-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J B:283-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J C:283-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J D:283-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J E:283-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J F:283-547 X-RAY DIFFRACTION 3.00
rasmol icon 1E0K A:283-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K B:283-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K C:283-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K D:283-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K E:283-547 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K F:283-547 X-RAY DIFFRACTION 3.30
rasmol icon 1Q57 A:283-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 B:283-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:283-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:283-547 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:283-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:283-547 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:283-547 Some residues were not observed X-RAY DIFFRACTION 3.45
Representative SF domain (8018194)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 304-505

Derived from SCOP domain 32286
rasmol icon 1CR1 A:304-505 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1CR0 A:304-505 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR2 A:304-505 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR4 A:304-505 Some residues were not observed X-RAY DIFFRACTION 2.50
rasmol icon 1E0J A:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J B:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J C:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J D:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J E:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J F:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0K A:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K B:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K C:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K D:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K E:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K F:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1Q57 A:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 B:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:304-505 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
Representative CF domain (8018195)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 304-537

Derived from SCOP domain 32286
rasmol icon 1CR1 A:304-537 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1CR0 A:304-537 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR2 A:304-537 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR4 A:304-537 Some residues were not observed X-RAY DIFFRACTION 2.50
rasmol icon 1E0J A:304-537 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J B:304-537 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J C:304-537 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J D:304-537 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J E:304-537 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J F:304-537 X-RAY DIFFRACTION 3.00
rasmol icon 1E0K A:304-537 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K B:304-537 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K C:304-537 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K D:304-537 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K E:304-537 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K F:304-537 X-RAY DIFFRACTION 3.30
rasmol icon 1Q57 A:304-537 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 B:304-537 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:304-537 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:304-537 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:304-537 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:304-537 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:304-537 Some residues were not observed X-RAY DIFFRACTION 3.45
Representative HF domain (8018196)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 304-505

Derived from SCOP domain 32286
rasmol icon 1CR1 A:304-505 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1CR0 A:304-505 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR2 A:304-505 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR4 A:304-505 Some residues were not observed X-RAY DIFFRACTION 2.50
rasmol icon 1E0J A:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J B:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J C:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J D:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J E:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0J F:304-505 X-RAY DIFFRACTION 3.00
rasmol icon 1E0K A:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K B:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K C:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K D:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K E:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1E0K F:304-505 X-RAY DIFFRACTION 3.30
rasmol icon 1Q57 A:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 B:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:304-505 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:304-505 Some residues were not observed X-RAY DIFFRACTION 3.45
Representative PR domain (8018197)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 10-255

Derived from SCOP domain 86194
rasmol icon 1NUI A:10-255 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 1NUI B:10-255 Some residues were not observed X-RAY DIFFRACTION 2.90
rasmol icon 1Q57 A:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 B:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 3.45
Representative FA domain (8018198)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 64-255

Derived from SCOP domain 86194
rasmol icon 1NUI A:64-255 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 1NUI B:64-255 X-RAY DIFFRACTION 2.90
rasmol icon 1Q57 A:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 B:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:64-255 X-RAY DIFFRACTION 3.45
Representative SF domain (8018199)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 64-255

Derived from SCOP domain 86194
rasmol icon 1NUI A:64-255 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 1NUI B:64-255 X-RAY DIFFRACTION 2.90
rasmol icon 1Q57 A:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 B:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:64-255 X-RAY DIFFRACTION 3.45
Representative CF domain (8018200)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 64-255

Derived from SCOP domain 86194
rasmol icon 1NUI A:64-255 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 1NUI B:64-255 X-RAY DIFFRACTION 2.90
rasmol icon 1Q57 A:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 B:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:64-255 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:64-255 X-RAY DIFFRACTION 3.45
Representative FA domain (8018201)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 10-63

Derived from SCOP domain 86195
rasmol icon 1NUI A:10-63 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 1NUI B:10-63 Some residues were not observed X-RAY DIFFRACTION 2.90
Representative SF domain (8018202)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 10-63

Derived from SCOP domain 86195
rasmol icon 1NUI A:10-63 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 1NUI B:10-63 Some residues were not observed X-RAY DIFFRACTION 2.90
Representative CF domain (8018203)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 10-63

Derived from SCOP domain 86195
rasmol icon 1NUI A:10-63 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 1NUI B:10-63 Some residues were not observed X-RAY DIFFRACTION 2.90
Representative SP domain (8018204)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 64-549

Derived from SCOP domain 95867
rasmol icon 1Q57 A:64-549 X-RAY DIFFRACTION 3.45
Clustered domains rasmol icon 1CR0 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR1 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.3
rasmol icon 1CR2 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR4 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.50
rasmol icon 1E0J A:261-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J B:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J C:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J D:261-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J E:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J F:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0K A:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K B:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K C:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K D:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K E:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K F:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1NUI A:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 2.90
rasmol icon 1NUI B:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 2.90
rasmol icon 1Q57 B:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:64-549 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45
Representative PR domain (8018205)
DNA primase/helicase

Enterobacteria phage T7 (10760)

 P03692 64-549

Derived from SCOP domain 95867
rasmol icon 1Q57 A:64-549 X-RAY DIFFRACTION 3.45
Clustered domains rasmol icon 1CR0 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR1 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.3
rasmol icon 1CR2 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.30
rasmol icon 1CR4 A:271-547 Some residues were not observed X-RAY DIFFRACTION 2.50
rasmol icon 1E0J A:261-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J B:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J C:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J D:261-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J E:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0J F:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1E0K A:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K B:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K C:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K D:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K E:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1E0K F:262-549 The ends of this domain were trimmed X-RAY DIFFRACTION 3.30
rasmol icon 1NUI A:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 2.90
rasmol icon 1NUI B:64-255 The ends of this domain were trimmed X-RAY DIFFRACTION 2.90
rasmol icon 1Q57 B:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 C:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 D:64-549 X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 E:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 F:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45
rasmol icon 1Q57 G:64-549 Some residues were not observed X-RAY DIFFRACTION 3.45