Representative Sequence

SPROT P54287

Voltage-dependent L-type calcium channel subunit beta-3 (12923)

1
61
121
181
241
301
361
421
481
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS PQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPV VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLDDACEHLAEYLEVYWRAT HHPAPGPGMLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHDHNDRNWQRNRPWP KDSY 60
120
180
240
300
360
420
480
484

Domains PDB ID RegionMethodResolution
Representative PR domain (8019100)
Voltage-dependent L-type calcium channel subunit beta-3

Rattus norvegicus (10116)

 P54287 31-362

Derived from SCOP domain 108917
rasmol icon 1VYU B:31-362 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1VYT A:38-362 Some residues were not observed X-RAY DIFFRACTION 2.6
rasmol icon 1VYT B:38-362 The ends of this domain were trimmed X-RAY DIFFRACTION 2.6
rasmol icon 1VYU A:39-362 Some residues were not observed X-RAY DIFFRACTION 2.3
Representative FA domain (8019101)
Voltage-dependent L-type calcium channel subunit beta-3

Rattus norvegicus (10116)

 P54287 178-361

Derived from SCOP domain 108917
rasmol icon 1VYU B:178-361 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1VYT A:178-361 Some residues were not observed X-RAY DIFFRACTION 2.6
rasmol icon 1VYT B:178-361 X-RAY DIFFRACTION 2.6
rasmol icon 1VYU A:178-361 Some residues were not observed X-RAY DIFFRACTION 2.3
Representative FA domain (8019102)
Voltage-dependent L-type calcium channel subunit beta-3

Rattus norvegicus (10116)

 P54287 58-124

Derived from SCOP domain 108916
rasmol icon 1VYU B:58-124 X-RAY DIFFRACTION 2.3
Clustered domains rasmol icon 1VYT A:58-124 X-RAY DIFFRACTION 2.6
rasmol icon 1VYT B:58-124 X-RAY DIFFRACTION 2.6
rasmol icon 1VYU A:58-124 X-RAY DIFFRACTION 2.3