Representative Sequence

SPROT P54288

Voltage-dependent L-type calcium channel subunit beta-2 (12925)

1
61
121
181
241
301
361
421
481
541
601
MNQASGLDLLKISYGKGARRKNRFKGSDGSTSSDTTSNSFVRQGSADSYTSRPSDSDVSL EEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFL HVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSSKSGGNSSSSL GDIVPSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK TEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLA KRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTS LAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLED ACEHLADYLEAYWKATHPPSSNLPNPLLSRTLATSALPVSPTLASNSQGSQGDQRTDRSA PARSASQAEEEPCLEPAKKSQHRSSSSAPHHNHRSGTSRGLSRQETFDSETQESRDSAYV EPKEDYSHEHVDHYAPHRDHNHRDETHRSSDHRHRETRHRSRDMDREQDHNECNKQRSRH KSKDRYCDKDGEVISKKRNEAGEWNRDVYIRQ 60
120
180
240
300
360
420
480
540
600
632

Domains PDB ID RegionMethodResolution
Representative PR domain (8019095)
Voltage-dependent L-type calcium channel subunit beta-2

Oryctolagus cuniculus (9986)

 P54288 60-441

Derived from SCOP domain 106359
rasmol icon 1T3L A:34-415 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1T3S A:35-415 The ends of this domain were trimmed X-RAY DIFFRACTION 2.30
rasmol icon 4DEX A:36-413 The ends of this domain were trimmed X-RAY DIFFRACTION 2.000
rasmol icon 4DEY A:35-414 Some residues were not observed X-RAY DIFFRACTION 1.950
Representative FA domain (8019096)
Voltage-dependent L-type calcium channel subunit beta-2

Oryctolagus cuniculus (9986)

 P54288 254-438

Derived from SCOP domain 106359
rasmol icon 1T3L A:228-412 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1T3S A:240-412 The ends of this domain were trimmed X-RAY DIFFRACTION 2.30
rasmol icon 4DEX A:228-412 X-RAY DIFFRACTION 2.000
rasmol icon 4DEY A:228-412 Some residues were not observed X-RAY DIFFRACTION 1.950
Representative FA domain (8019097)
Voltage-dependent L-type calcium channel subunit beta-2

Oryctolagus cuniculus (9986)

 P54288 87-151

Derived from SCOP domain 106358
rasmol icon 1T3L A:61-125 X-RAY DIFFRACTION 2.20
Clustered domains rasmol icon 1T3S A:61-125 X-RAY DIFFRACTION 2.30
rasmol icon 4DEX A:61-125 X-RAY DIFFRACTION 2.000
rasmol icon 4DEY A:61-125 X-RAY DIFFRACTION 1.950