Representative Sequence

SPROT P31016

Disks large homolog 4 (14024)

1
61
121
181
241
301
361
421
481
541
601
661
721
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGE MEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFV NEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGN QHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVY LKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKD LLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQIL SVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDS ETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIIL GPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIE AGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLE INKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPA RERL 60
120
180
240
300
360
420
480
540
600
660
720
724

Domains PDB ID RegionMethodResolution
Representative PR domain (8019107)
Disks large homolog 4
complexed with so4

Rattus norvegicus (10116)

 P31016 430-724

Derived from SCOP domain 68644
rasmol icon 1KJW A:430-724 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1JXM A:430-724 Some residues were not observed X-RAY DIFFRACTION 2.00
rasmol icon 1JXO A:430-720 The ends of this domain were trimmed X-RAY DIFFRACTION 2.30
rasmol icon 1JXO B:430-720 The ends of this domain were trimmed X-RAY DIFFRACTION 2.30
rasmol icon 2XKX A:427-721 ELECTRON MICROSCOPY; SOLUTION SCATTERING 22.9
rasmol icon 2XKX B:427-721 Some residues were not observed ELECTRON MICROSCOPY; SOLUTION SCATTERING 22.9
rasmol icon 3WP0 A:533-713 The ends of this domain were trimmed X-RAY DIFFRACTION 2.039
rasmol icon 3WP1 B:533-712 The ends of this domain were trimmed X-RAY DIFFRACTION 2.804

Rattus (10114)

rasmol icon 5B64 A:533-712 The ends of this domain were trimmed X-RAY DIFFRACTION 2.700
Representative FA domain (8019108)
Disks large homolog 4
complexed with so4

Rattus norvegicus (10116)

 P31016 532-713

Derived from SCOP domain 68644
rasmol icon 1KJW A:532-713 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1JXM A:532-713 X-RAY DIFFRACTION 2.00
rasmol icon 1JXO A:532-713 X-RAY DIFFRACTION 2.30
rasmol icon 1JXO B:532-713 X-RAY DIFFRACTION 2.30
rasmol icon 2XKX A:529-710 ELECTRON MICROSCOPY; SOLUTION SCATTERING 22.9
rasmol icon 2XKX B:529-710 ELECTRON MICROSCOPY; SOLUTION SCATTERING 22.9
rasmol icon 3WP0 A:533-713 The ends of this domain were trimmed X-RAY DIFFRACTION 2.039
rasmol icon 3WP1 B:533-712 The ends of this domain were trimmed X-RAY DIFFRACTION 2.804

Rattus (10114)

rasmol icon 5B64 A:533-712 The ends of this domain were trimmed X-RAY DIFFRACTION 2.700
Representative FA domain (8019109)
Disks large homolog 4
complexed with so4

Rattus norvegicus (10116)

 P31016 430-494

Derived from SCOP domain 68643
rasmol icon 1KJW A:430-494 X-RAY DIFFRACTION 1.8
Clustered domains rasmol icon 1JXM A:430-494 X-RAY DIFFRACTION 2.00
rasmol icon 1JXO A:430-494 X-RAY DIFFRACTION 2.30
rasmol icon 1JXO B:430-494 X-RAY DIFFRACTION 2.30
rasmol icon 2XKX A:427-491 ELECTRON MICROSCOPY; SOLUTION SCATTERING 22.9
rasmol icon 2XKX B:427-491 ELECTRON MICROSCOPY; SOLUTION SCATTERING 22.9