Representative Sequence

SPROT P31742

Type II secretion system protein E (14573)

1
61
121
181
241
301
361
421
481
541
MEQRSAETRIVEALLERRRLKDTDLVRARQLQAESGMGLLALLGRLGLVSERDHAETCAE VLGLPLVDARQLGDTPPEMLPEVQGLSLRFLKQFHLCPVGERDGRLDLWIADPYDDYAID AVRLATGLPLLLQVGLRSEIDDLIERWYGQGRSAMGTIVETADGDASSTDDIEALRDLAS EAPVIRLVNLVIQHAVELRASDIHIEPFESRLKVRYRVDGVLVEGESPPAKLTAAVISRI KIMAKLNIAERRLPQDGRIMLRVQGKELDLRVSTVPTAHGESVVMRLLDRETVVFDFYKL GFTEDFLPQFRKVLEQPHGIMLVTGPTGSGKTTTLYTALSQLNTSDVKIITVEDPVEYQI EGINQIQAKPQIGLDFANALRSIVRQDPDIIMIGEMRDLETARIAIQSALTGHLVLSTLH TNNAAGGITRLLDMGVEDYLLTSTINGILAQRLVRKLDLANAERYAASPEEIERFDLRRL QPDGEIFLYRPRATAAAPTGYLGRTTIVEFLVMNDELRRAVMRRAGMGEIEQLARKSGMR TMYEDGLSKALRGETTIEEVLRVTEDA 60
120
180
240
300
360
420
480
540
567

Domains PDB ID RegionMethodResolution
Representative PR domain (8018138)
Type II secretion system protein E

Xanthomonas campestris (339)

 P31742 1-149

Derived from SCOP domain 146450
rasmol icon 2D28 C:1-149 X-RAY DIFFRACTION 2.000
Clustered domains rasmol icon 2D27 A:1-148 The ends of this domain were trimmed X-RAY DIFFRACTION 2.210
Representative FA domain (8018139)
Type II secretion system protein E

Xanthomonas campestris (339)

 P31742 82-149

Derived from SCOP domain 146450
rasmol icon 2D28 C:82-149 X-RAY DIFFRACTION 2.000
Clustered domains rasmol icon 2D27 A:82-148 The ends of this domain were trimmed X-RAY DIFFRACTION 2.210
Representative FA domain (8018140)
Type II secretion system protein E

Xanthomonas campestris (339)

 P31742 4-64

Derived from SCOP domain 146450
rasmol icon 2D28 C:4-64 X-RAY DIFFRACTION 2.000
Clustered domains rasmol icon 2D27 A:4-64 X-RAY DIFFRACTION 2.210
Representative CF domain (8018141)
Type II secretion system protein E

Xanthomonas campestris (339)

 P31742 4-64

Derived from SCOP domain 146450
rasmol icon 2D28 C:4-64 X-RAY DIFFRACTION 2.000
Clustered domains rasmol icon 2D27 A:4-64 X-RAY DIFFRACTION 2.210