Representative Sequence

SPROT P32769

Elongation factor 1 alpha-like protein (15459)

1
61
121
181
241
301
361
421
481
541
601
MAYSDYSDGADDMPDFHDEGEFDDYLNDDEYDLMNEVFPTLKAQLQDYQGWDNLSLKLAL FDNNFDLESTLAELKKTLKKKKTPKKPIAAANGSANVTQKLANISISQQRPNDRLPDWLD EEESEGERNGEEANDEKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGK STLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHF STHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLA SSLGIHNLIIAMNKMDNVDWSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVY KIEYTDEVRQWYNGPNLMSTLENAAFKISKENEGINKDDPFLFSVLEIIPSKKTSNDLAL VSGKLESGSIQPGESLTIYPSEQSCIVDKIQVGSQQGQSTNHEETDVAIKGDFVTLKLRK AYPEDIQNGDLAASVDYSSIHSAQCFVLELTTFDMNRPLLPGTPFILFIGVKEQPARIKR LISFIDKGNTASKKKIRHLGSKQRAFVEIELIEVKRWIPLLTAHENDRLGRVVLRKDGRT IAAGKISEITQ 60
120
180
240
300
360
420
480
540
600
611

Domains PDB ID RegionMethodResolution
Representative PR domain (8019766)
Elongation factor 1 alpha-like protein

Saccharomyces cerevisiae (4932)

 P32769 139-611

rasmol icon 3P26 A:139-611 X-RAY DIFFRACTION 2.50
Clustered domains rasmol icon 3IZQ 1:139-611 ELECTRON MICROSCOPY n/a
rasmol icon 3P26 B:139-611 X-RAY DIFFRACTION 2.50
rasmol icon 3P27 A:139-611 Some residues were not observed X-RAY DIFFRACTION 2.95
rasmol icon 3P27 B:139-611 Some residues were not observed X-RAY DIFFRACTION 2.95
Representative FA domain (8019767)
Elongation factor 1 alpha-like protein

Saccharomyces cerevisiae (4932)

 P32769 165-495

rasmol icon 3P26 A:165-495 X-RAY DIFFRACTION 2.50
Clustered domains rasmol icon 3IZQ 1:165-495 ELECTRON MICROSCOPY n/a
rasmol icon 3P26 B:165-495 X-RAY DIFFRACTION 2.50
rasmol icon 3P27 A:165-495 Some residues were not observed X-RAY DIFFRACTION 2.95
rasmol icon 3P27 B:165-495 Some residues were not observed X-RAY DIFFRACTION 2.95
Representative FA domain (8019768)
Elongation factor 1 alpha-like protein

Saccharomyces cerevisiae (4932)

 P32769 500-611

rasmol icon 3P26 A:500-611 X-RAY DIFFRACTION 2.50
Clustered domains rasmol icon 3IZQ 1:500-611 ELECTRON MICROSCOPY n/a
rasmol icon 3P26 B:500-611 X-RAY DIFFRACTION 2.50
rasmol icon 3P27 A:500-611 X-RAY DIFFRACTION 2.95
rasmol icon 3P27 B:500-611 X-RAY DIFFRACTION 2.95