Representative Sequence

SPROT P04397

Bifunctional protein GAL10 [Includes: UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)] (1583)

1
61
121
181
241
301
361
421
481
541
601
661
MTAQLQSESTSKIVLVTGGAGYIGSHTVVELIENGYDCVVADNLSNSTYDSVARLEVLTK HHIPFYEVDLCDRKGLEKVFKEYKIDSVIHFAGLKAVGESTQIPLRYYHNNILGTVVLLE LMQQYNVSKFVFSSSATVYGDATRFPNMIPIPEECPLGPTNPYGHTKYAIENILNDLYNS DKKSWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVGRREKLYIFGDDYDSR DGTPIRDYIHVVDLAKGHIAALQYLEAYNENEGLCREWNLGSGKGSTVFEVYHAFCKASG IDLPYKVTGRRAGDVLNLTAKPDRAKRELKWQTELQVEDSCKDLWKWTTENPFGYQLRGV EARFSAEDMRYDARFVTIGAGTRFQATFANLGASIVDLKVNGQSVVLGYENEEGYLNPDS AYIGATIGRYANRISKGKFSLCNKDYQLTVNNGVNANHSSIGSFHRKRFLGPIIQNPSKD VFTAEYMLIDNEKDTEFPGDLLVTIQYTVNVAQKSLEMVYKGKLTAGEATPINLTNHSYF NLNKPYGDTIEGTEIMVRSKKSVDVDKNMIPTGNIVDREIATFNSTKPTVLGPKNPQFDC CFVVDENAKPSQINTLNNELTLIVKAFHPDSNITLEVLSTEPTYQFYTGDFLSAGYEARQ GFAIEPGRYIDAINQENWKDCVTLKNGETYGSKIVYRFS 60
120
180
240
300
360
420
480
540
600
660
699

Domains PDB ID RegionMethodResolution
Representative PR domain (8000089)
Bifunctional protein GAL10 [Includes: UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)]
complexed with gal, gud, na, nad, mutant

Saccharomyces cerevisiae (4932)

 P04397 358-699

Derived from SCOP domain 124427
rasmol icon 1Z45 A:358-699 X-RAY DIFFRACTION 1.85
Representative SP domain (8000265)
Bifunctional protein GAL10 [Includes: UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)]
fusion of two stand-alone proteins; complexed with gal, gud, na, nad, mutant

Saccharomyces cerevisiae (4932)

 P04397 11-699

Derived from SCOP domain 124428
rasmol icon 1Z45 A:11-699 X-RAY DIFFRACTION 1.85
Representative PR domain (8001499)
Bifunctional protein GAL10 [Includes: UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)]
complexed with gal, gud, na, nad, mutant

Saccharomyces cerevisiae (4932)

 P04397 11-357

Derived from SCOP domain 124428
rasmol icon 1Z45 A:11-357 X-RAY DIFFRACTION 1.85
Representative FA domain (8001529)
Bifunctional protein GAL10 [Includes: UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)]
complexed with gal, gud, na, nad, mutant

Saccharomyces cerevisiae (4932)

 P04397 358-699

Derived from SCOP domain 124427
rasmol icon 1Z45 A:358-699 X-RAY DIFFRACTION 1.85
Representative SF domain (8001530)
Bifunctional protein GAL10 [Includes: UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)]
complexed with gal, gud, na, nad, mutant

Saccharomyces cerevisiae (4932)

 P04397 358-699

Derived from SCOP domain 124427
rasmol icon 1Z45 A:358-699 X-RAY DIFFRACTION 1.85
Representative CF domain (8001531)
Bifunctional protein GAL10 [Includes: UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase); Aldose 1-epimerase (EC 5.1.3.3) (Mutarotase)]
complexed with gal, gud, na, nad, mutant

Saccharomyces cerevisiae (4932)

 P04397 358-699

Derived from SCOP domain 124427
rasmol icon 1Z45 A:358-699 X-RAY DIFFRACTION 1.85