Representative Sequence

SPROT P33650

Ferrous iron transport protein B (16007)

1
61
121
181
241
301
361
421
481
541
601
661
721
MKKLTIGLIGNPNSGKTTLFNQLTGSRQRVGNWAGVTVERKEGQFSTTDHQVTLVDLPGT YSLTTISSQTSLDEQIACHYILSGDADLLINVVDASNLERNLYLTLQLLELGIPCIVALN MLDIAEKQNIRIEIDALSARLGCPVIPLVSTRGRGIEALKLAIDRYKANENVELVHYAQP LLNEADSLAKVMPSDIPLKQRRWLGLQMLEGDIYSRAYAGEASQHLDAALARLRNEMDDP ALHIADARYQCIAAICDVVSNTLTAEPSRFTTAVDKIVLNRFLGLPIFLFVMYLMFLLAI NIGGALQPLFDVGSVALFVHGIQWIGYTLHFPDWLTIFLAQGLGGGINTVLPLVPQIGMM YLFLSFLEDSGYMARAAFVMDRLMQALGLPGKSFVPLIVGFGCNVPSVMGARTLDAPRER LMTIMMAPFMSCGARLAIFAVFAAAFFGQNGALAVFSLYMLGIVMAVLTGLMLKYTIMRG EATPFVMELPVYHVPHVKSLIIQTWQRLKGFVLRAGKVIIIVSIFLSAFNSFSLSGKIVD NINDSALASVSRVITPVFKPIGVHEDNWQATVGLFTGAMAKEVVVGTLNTLYTAENIQDE EFNPAEFNLGEELFSAIDETWQSLKDTFSLSVLMNPIEASKGDGEMGTGAMGVMDQKFGS AAAAYSYLIFVLLYVPCISVMGAIARESSRGWMGFSILWGLNIAYSLATLFYQVASYSQH PTYSLVCILAVILFNIVVIGLLRRARSRVDIELLATRKSVSSCCAASTTGDCH 60
120
180
240
300
360
420
480
540
600
660
720
773

Domains PDB ID RegionMethodResolution
Representative SP domain (8019387)
Ferrous iron transport protein B

Escherichia coli (562)

 P33650 1-264

rasmol icon 3I8S A:1-264 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 3HYR A:2-260 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR B:2-260 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR C:2-260 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYT A:2-261 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT B:2-260 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT C:2-261 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3I8S B:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 3I8S C:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 3I8X A:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 2.25
rasmol icon 3I8X B:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 2.25
rasmol icon 3I8X C:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 2.25
rasmol icon 3I92 A:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 3I92 B:2-261 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 3I92 C:2-262 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00

Escherichia coli K-12 (83333)

rasmol icon 4Q00 A:2-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 B:1-261 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 C:2-260 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q5I A:3-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I B:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I C:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I D:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I E:1-264 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I F:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80
rasmol icon 4R98 A:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 4R98 B:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
Representative PR domain (8019388)
Ferrous iron transport protein B

Escherichia coli (562)

 P33650 1-264

rasmol icon 3I8S A:1-264 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 3HYR A:2-260 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR B:2-260 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR C:2-260 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYT A:2-261 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT B:2-260 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT C:2-261 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3I8S B:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 3I8S C:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80
rasmol icon 3I8X A:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 2.25
rasmol icon 3I8X B:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 2.25
rasmol icon 3I8X C:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 2.25
rasmol icon 3I92 A:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 3I92 B:2-261 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 3I92 C:2-262 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00

Escherichia coli K-12 (83333)

rasmol icon 4Q00 A:2-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 B:1-261 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 C:2-260 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q5I A:3-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I B:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I C:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I D:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I E:1-264 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I F:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80
rasmol icon 4R98 A:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 4R98 B:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
Representative FA domain (8019389)
Ferrous iron transport protein B

Escherichia coli (562)

 P33650 1-167

rasmol icon 3I8S A:1-167 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 3HYR A:2-167 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR B:2-167 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR C:2-167 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYT A:2-167 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT B:2-167 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT C:2-167 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3I8S B:1-167 X-RAY DIFFRACTION 1.80
rasmol icon 3I8S C:1-167 X-RAY DIFFRACTION 1.80
rasmol icon 3I8X A:1-167 X-RAY DIFFRACTION 2.25
rasmol icon 3I8X B:1-167 X-RAY DIFFRACTION 2.25
rasmol icon 3I8X C:1-167 X-RAY DIFFRACTION 2.25
rasmol icon 3I92 A:1-167 X-RAY DIFFRACTION 3.00
rasmol icon 3I92 B:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 3I92 C:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00

Escherichia coli K-12 (83333)

rasmol icon 4Q00 A:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 B:1-167 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 C:2-167 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q5I A:3-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I B:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I C:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I D:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I E:1-167 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I F:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80
rasmol icon 4R98 A:2-168 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 4R98 B:2-168 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
Representative SF domain (8019390)
Ferrous iron transport protein B

Escherichia coli (562)

 P33650 1-167

rasmol icon 3I8S A:1-167 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 3HYR A:2-167 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR B:2-167 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR C:2-167 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYT A:2-167 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT B:2-167 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT C:2-167 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3I8S B:1-167 X-RAY DIFFRACTION 1.80
rasmol icon 3I8S C:1-167 X-RAY DIFFRACTION 1.80
rasmol icon 3I8X A:1-167 X-RAY DIFFRACTION 2.25
rasmol icon 3I8X B:1-167 X-RAY DIFFRACTION 2.25
rasmol icon 3I8X C:1-167 X-RAY DIFFRACTION 2.25
rasmol icon 3I92 A:1-167 X-RAY DIFFRACTION 3.00
rasmol icon 3I92 B:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 3I92 C:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00

Escherichia coli K-12 (83333)

rasmol icon 4Q00 A:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 B:1-167 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 C:2-167 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q5I A:3-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I B:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I C:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I D:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I E:1-167 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I F:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80
rasmol icon 4R98 A:2-168 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 4R98 B:2-168 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
Representative CF domain (8019391)
Ferrous iron transport protein B

Escherichia coli (562)

 P33650 1-167

rasmol icon 3I8S A:1-167 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 3HYR A:2-167 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR B:2-167 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR C:2-167 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYT A:2-167 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT B:2-167 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT C:2-167 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3I8S B:1-167 X-RAY DIFFRACTION 1.80
rasmol icon 3I8S C:1-167 X-RAY DIFFRACTION 1.80
rasmol icon 3I8X A:1-167 X-RAY DIFFRACTION 2.25
rasmol icon 3I8X B:1-167 X-RAY DIFFRACTION 2.25
rasmol icon 3I8X C:1-167 X-RAY DIFFRACTION 2.25
rasmol icon 3I92 A:1-167 X-RAY DIFFRACTION 3.00
rasmol icon 3I92 B:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 3I92 C:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00

Escherichia coli K-12 (83333)

rasmol icon 4Q00 A:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 B:1-167 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 C:2-167 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q5I A:3-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I B:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I C:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I D:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I E:1-167 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I F:2-167 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80
rasmol icon 4R98 A:2-168 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 4R98 B:2-168 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
Representative HF domain (8019392)
Ferrous iron transport protein B

Escherichia coli (562)

 P33650 1-95

rasmol icon 3I8S A:1-95 X-RAY DIFFRACTION 1.80
Clustered domains rasmol icon 3HYR A:2-95 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR B:2-95 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYR C:2-95 Some residues were not observed X-RAY DIFFRACTION 2.20
rasmol icon 3HYT A:2-95 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT B:2-95 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3HYT C:2-95 Some residues were not observed X-RAY DIFFRACTION 2.74
rasmol icon 3I8S B:1-95 X-RAY DIFFRACTION 1.80
rasmol icon 3I8S C:1-95 X-RAY DIFFRACTION 1.80
rasmol icon 3I8X A:1-95 X-RAY DIFFRACTION 2.25
rasmol icon 3I8X B:1-95 X-RAY DIFFRACTION 2.25
rasmol icon 3I8X C:1-95 X-RAY DIFFRACTION 2.25
rasmol icon 3I92 A:1-95 X-RAY DIFFRACTION 3.00
rasmol icon 3I92 B:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 3I92 C:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00

Escherichia coli K-12 (83333)

rasmol icon 4Q00 A:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 B:1-95 Some residues were not observed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q00 C:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1000

Escherichia coli K-12 (83333)

rasmol icon 4Q5I A:3-95 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I B:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I C:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I D:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I E:1-95 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 4Q5I F:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80
rasmol icon 4R98 A:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22
rasmol icon 4R98 B:2-95 The ends of this domain were trimmed X-RAY DIFFRACTION 2.22