Representative Sequence

SPROT O74774

Elongation factor 1 alpha-like protein (16640)

1
61
121
181
241
301
361
421
481
541
MSRHRDVKNLDLDDYELDEEPGEEELTEEQEEEFRSAVATVRETLLGVPISEKEIADTVW YYYFDVEKSVNYLLQKASSKAGAKEKQNTDSQKEKKQNKSKEALADAKDPLDESSNGIKN LSLNKNDEPAFQTNGEVKMKNSSESDNQPEKKKIKKQNPTDLVSVPEIFEQSNPKPVVHL VVTGHVDSGKSTMLGRIMFELGEINSRSMQKLHNEAANSGKGSFSYAWLLDTTEEERARG VTMDVASTTFESDKKIYEIGDAPGHRDFISGMIAGASSADFAVLVVDSSQNNFERGFLEN GQTREHAYLLRALGISEIVVSVNKLDLMSWSEDRFQEIKNIVSDFLIKMVGFKTSNVHFV PISAISGTNLIQKDSSDLYKWYKGPTLLSALDQLVPPEKPYRKPLRLSIDDVYRSPRSVT VTGRVEAGNVQVNQVLYDVSSQEDAYVKNVIRNSDPSSTWAVAGDTVTLQLADIEVNQLR PGDILSNYENPVRRVRSFVAEIQTFDIHGPILSGSTLVLHLGRTVTSVSLKIVTVNNKRS RHIASRKRALVRISFLDGLFPLCLAEECPALGRFILRRSGDTVAAGIVKELC 60
120
180
240
300
360
420
480
540
592

Domains PDB ID RegionMethodResolution
Representative PR domain (8019769)
Elongation factor 1 alpha-like protein

Schizosaccharomyces pombe (4896)

 O74774 155-592

rasmol icon 3MCA A:155-592 X-RAY DIFFRACTION 2.7400