Representative Sequence

SPROT O27564

Calcium-gated potassium channel mthK (191)

1
61
121
181
241
301
MVLVIEIIRKHLPRVLKVPATRILLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATV GYGDYSPSTPLGMYFTVTLIVLGIGTFAVAVERLLEFLINREQMKLMGLIDVAKSRHVVI CGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARA VIVDLESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRLMS RSIDDGYEAMFVQDVLAEESTRRMVEVPIPEGSKLEGVSVLDADIHDVTGVIIIGVGRGD ELIIDPPRDYSFRAGDIILGIGKPEEIERLKNYISA 60
120
180
240
300
336

Domains PDB ID RegionMethodResolution
Representative FA domain (8000184)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 261-336

Derived from SCOP domain 134346
rasmol icon 2FY8 A:261-336 X-RAY DIFFRACTION 2.79
Clustered domains rasmol icon 1LNQ A:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ B:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 2AEF A:261-336 X-RAY DIFFRACTION 1.7
rasmol icon 2AEF B:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7
rasmol icon 2AEJ A:261-336 X-RAY DIFFRACTION 2.1
rasmol icon 2AEJ B:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEM A:261-336 X-RAY DIFFRACTION 2.8
rasmol icon 2FY8 B:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 C:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 D:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 E:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 F:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 G:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 H:261-336 X-RAY DIFFRACTION 2.79

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 2OGU A:261-336 X-RAY DIFFRACTION 3.23

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD A:261-336 X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD B:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX A:261-336 X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX B:261-336 X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX C:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX D:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX E:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX F:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 A:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 B:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 C:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 D:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 E:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 F:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 G:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 H:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 I:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 J:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 K:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 L:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 M:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 N:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 O:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 P:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 A:261-336 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 B:261-336 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 A:261-336 X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 B:261-336 X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 A:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 B:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 C:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 D:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 E:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 F:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 A:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 B:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 C:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 D:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 E:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 F:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 A:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 B:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 C:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 D:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 E:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 F:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 G:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 H:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 I:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 J:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 K:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 L:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 M:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 N:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 O:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 P:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 Q:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 R:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 S:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 T:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 a:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 b:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 c:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 d:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 e:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 f:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 g:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 h:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 i:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 j:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 k:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 l:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 m:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 n:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 o:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 p:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 q:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 r:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 s:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 t:261-336 X-RAY DIFFRACTION 3.18
Representative FA domain (8000677)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 115-260

Derived from SCOP domain 134345
rasmol icon 2FY8 A:115-260 X-RAY DIFFRACTION 2.79
Clustered domains rasmol icon 1LNQ A:115-260 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ B:115-260 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:115-260 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:115-260 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:115-260 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:115-260 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:115-260 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:115-260 X-RAY DIFFRACTION 3.30
rasmol icon 2AEF A:116-257 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7
rasmol icon 2AEF B:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7
rasmol icon 2AEJ A:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEJ B:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEM A:115-260 X-RAY DIFFRACTION 2.8
rasmol icon 2FY8 B:115-260 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 C:115-260 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 D:115-260 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 E:115-260 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 F:115-260 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 G:115-260 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 H:115-260 X-RAY DIFFRACTION 2.79

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 2OGU A:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.23

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD A:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD B:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX A:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX B:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX C:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX D:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX E:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX F:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:115-260 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:115-260 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:115-260 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 A:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 B:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 C:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 D:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 E:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 F:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 G:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 H:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 I:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 J:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 K:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 L:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 M:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 N:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 O:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 P:115-260 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 A:115-260 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 B:115-260 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 A:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 B:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 A:115-260 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 B:115-260 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 C:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 D:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 E:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 F:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 A:115-260 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 B:115-260 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 C:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 D:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 E:115-260 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 F:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 A:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 B:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 C:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 D:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 E:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 F:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 G:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 H:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 I:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 J:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 K:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 L:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 M:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 N:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 O:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 P:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 Q:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 R:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 S:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 T:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 a:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 b:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 c:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 d:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 e:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 f:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 g:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 h:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 i:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 j:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 k:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 l:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 m:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 n:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 o:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 p:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 q:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 r:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 s:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 t:116-260 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18
Representative PR domain (8000876)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 115-336

Derived from SCOP domain 134345
rasmol icon 2FY8 A:115-336 X-RAY DIFFRACTION 2.79
Clustered domains rasmol icon 1LNQ A:115-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ B:115-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:115-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:115-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:115-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:115-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:115-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:115-336 X-RAY DIFFRACTION 3.30
rasmol icon 2AEF A:116-336 Some residues were not observed X-RAY DIFFRACTION 1.7
rasmol icon 2AEF B:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7
rasmol icon 2AEJ A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEJ B:116-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEM A:115-336 X-RAY DIFFRACTION 2.8
rasmol icon 2FY8 B:115-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 C:115-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 D:115-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 E:115-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 F:115-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 G:115-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 H:115-336 X-RAY DIFFRACTION 2.79

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 2OGU A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.23

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD B:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX B:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX C:116-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX D:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX E:116-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX F:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:115-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:115-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:115-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 A:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 B:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 C:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 D:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 E:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 F:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 G:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 H:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 I:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 J:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 K:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 L:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 M:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 N:115-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 O:115-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 P:115-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 A:115-336 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 B:115-336 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 B:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 A:115-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 B:115-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 D:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 E:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 F:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 A:115-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 B:115-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 D:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 E:115-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 F:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 B:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 D:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 E:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 F:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 G:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 H:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 I:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 J:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 K:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 L:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 M:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 N:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 O:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 P:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 Q:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 R:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 S:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 T:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 a:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 b:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 c:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 d:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 e:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 f:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 g:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 h:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 i:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 j:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 k:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 l:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 m:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 n:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 o:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 p:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 q:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 r:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 s:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 t:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18
Representative SP domain (8001508)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 19-336

Derived from SCOP domain 74050
rasmol icon 1LNQ A:19-336 X-RAY DIFFRACTION 3.30
Clustered domains rasmol icon 1LNQ B:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 2AEF A:116-336 Some residues were not observed X-RAY DIFFRACTION 1.7
rasmol icon 2AEF B:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7
rasmol icon 2AEJ A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEJ B:116-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEM A:113-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8
rasmol icon 2FY8 A:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 C:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 D:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 E:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 F:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 G:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 H:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 2OGU A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.23

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD B:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDC A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDD A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDE A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 2.208

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3OUS A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3R65 A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX B:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX C:116-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX D:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX E:116-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX F:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:24-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:27-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:26-336 Some residues were not observed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:24-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 A:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 C:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 D:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 E:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 F:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 G:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 H:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 I:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 J:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 K:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 L:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 M:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 N:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 O:115-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 P:115-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO B:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO C:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO D:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO E:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO F:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO G:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO H:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 B:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 C:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 D:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 E:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 F:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 G:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 H:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 A:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 B:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 A:111-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 D:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 E:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 F:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 A:113-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 D:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 E:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 F:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE7 A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 2.40

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE9 A:19-100 The ends of this domain were trimmed X-RAY DIFFRACTION 2.15

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 B:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 D:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 E:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 F:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 G:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 H:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 I:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 J:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 K:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 L:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 M:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 N:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 O:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 P:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 Q:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 R:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 S:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 T:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 a:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 b:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 c:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 d:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 e:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 f:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 g:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 h:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 i:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 j:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 k:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 l:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 m:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 n:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 o:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 p:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 q:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 r:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 s:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 t:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18
Representative PR domain (8001509)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 19-336

Derived from SCOP domain 74050
rasmol icon 1LNQ A:19-336 X-RAY DIFFRACTION 3.30
Clustered domains rasmol icon 1LNQ B:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:19-336 X-RAY DIFFRACTION 3.30
rasmol icon 2AEF A:116-336 Some residues were not observed X-RAY DIFFRACTION 1.7
rasmol icon 2AEF B:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7
rasmol icon 2AEJ A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEJ B:116-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEM A:113-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.8
rasmol icon 2FY8 A:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 C:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 D:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 E:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 F:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 G:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 H:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.79

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 2OGU A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.23

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD B:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDC A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDD A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDE A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 2.208

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3OUS A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3R65 A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.80

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX B:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX C:116-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX D:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX E:116-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX F:116-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:24-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:27-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:26-336 Some residues were not observed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:24-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 A:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 C:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 D:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 E:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 F:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 G:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 H:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 I:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 J:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 K:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 L:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 M:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 N:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 O:115-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 P:115-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO B:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO C:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO D:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO E:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO F:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO G:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO H:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 B:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 C:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 D:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 E:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 F:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 G:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 H:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 A:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 B:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 A:111-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 D:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 E:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 F:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 A:113-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 B:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 D:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 E:115-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 F:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE7 A:19-99 The ends of this domain were trimmed X-RAY DIFFRACTION 2.40

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE9 A:19-100 The ends of this domain were trimmed X-RAY DIFFRACTION 2.15

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 A:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 B:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 C:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 D:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 E:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 F:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 G:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 H:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 I:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 J:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 K:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 L:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 M:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 N:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 O:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 P:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 Q:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 R:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 S:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 T:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 a:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 b:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 c:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 d:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 e:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 f:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 g:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 h:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 i:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 j:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 k:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 l:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 m:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 n:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 o:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 p:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 q:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 r:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 s:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 t:116-336 The ends of this domain were trimmed X-RAY DIFFRACTION 3.18
Representative FA domain (8001510)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 19-98

Derived from SCOP domain 74050
rasmol icon 1LNQ A:19-98 X-RAY DIFFRACTION 3.30
Clustered domains rasmol icon 1LNQ B:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:19-98 X-RAY DIFFRACTION 3.30

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDC A:19-98 X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDD A:19-98 X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDE A:19-98 X-RAY DIFFRACTION 2.208

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3OUS A:19-98 X-RAY DIFFRACTION 1.7500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3R65 A:19-98 X-RAY DIFFRACTION 1.80

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:24-98 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:27-98 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:26-96 Some residues were not observed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:24-98 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO A:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO B:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO C:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO D:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO E:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO F:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO G:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO H:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 A:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 B:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 C:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 D:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 E:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 F:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 G:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 H:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE7 A:19-98 X-RAY DIFFRACTION 2.40

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE9 A:19-98 X-RAY DIFFRACTION 2.15
Representative SF domain (8001548)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 19-98

Derived from SCOP domain 74050
rasmol icon 1LNQ A:19-98 X-RAY DIFFRACTION 3.30
Clustered domains rasmol icon 1LNQ B:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:19-98 X-RAY DIFFRACTION 3.30

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDC A:19-98 X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDD A:19-98 X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDE A:19-98 X-RAY DIFFRACTION 2.208

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3OUS A:19-98 X-RAY DIFFRACTION 1.7500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3R65 A:19-98 X-RAY DIFFRACTION 1.80

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:24-98 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:27-98 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:26-96 Some residues were not observed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:24-98 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO A:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO B:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO C:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO D:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO E:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO F:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO G:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO H:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 A:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 B:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 C:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 D:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 E:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 F:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 G:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 H:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE7 A:19-98 X-RAY DIFFRACTION 2.40

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE9 A:19-98 X-RAY DIFFRACTION 2.15
Representative CF domain (8001549)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 19-98

Derived from SCOP domain 74050
rasmol icon 1LNQ A:19-98 X-RAY DIFFRACTION 3.30
Clustered domains rasmol icon 1LNQ B:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:19-98 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:19-98 X-RAY DIFFRACTION 3.30

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDC A:19-98 X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDD A:19-98 X-RAY DIFFRACTION 1.45

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3LDE A:19-98 X-RAY DIFFRACTION 2.208

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3OUS A:19-98 X-RAY DIFFRACTION 1.7500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3R65 A:19-98 X-RAY DIFFRACTION 1.80

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:24-98 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:27-98 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:26-96 Some residues were not observed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:24-98 The ends of this domain were trimmed X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO A:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO B:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO C:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO D:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO E:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO F:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO G:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HYO H:19-98 X-RAY DIFFRACTION 1.65

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 A:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 B:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 C:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 D:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 E:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 F:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 G:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4HZ3 H:19-98 X-RAY DIFFRACTION 1.700

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE7 A:19-98 X-RAY DIFFRACTION 2.40

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4QE9 A:19-98 X-RAY DIFFRACTION 2.15
Representative SF domain (8001554)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 261-336

Derived from SCOP domain 134346
rasmol icon 2FY8 A:261-336 X-RAY DIFFRACTION 2.79
Clustered domains rasmol icon 1LNQ A:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ B:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 2AEF A:261-336 X-RAY DIFFRACTION 1.7
rasmol icon 2AEF B:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7
rasmol icon 2AEJ A:261-336 X-RAY DIFFRACTION 2.1
rasmol icon 2AEJ B:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEM A:261-336 X-RAY DIFFRACTION 2.8
rasmol icon 2FY8 B:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 C:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 D:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 E:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 F:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 G:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 H:261-336 X-RAY DIFFRACTION 2.79

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 2OGU A:261-336 X-RAY DIFFRACTION 3.23

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD A:261-336 X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD B:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX A:261-336 X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX B:261-336 X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX C:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX D:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX E:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX F:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 A:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 B:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 C:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 D:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 E:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 F:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 G:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 H:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 I:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 J:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 K:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 L:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 M:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 N:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 O:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 P:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 A:261-336 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 B:261-336 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 A:261-336 X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 B:261-336 X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 A:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 B:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 C:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 D:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 E:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L75 F:261-336 X-RAY DIFFRACTION 2.393

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 A:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 B:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 C:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 D:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 E:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L76 F:261-336 X-RAY DIFFRACTION 2.992

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 A:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 B:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 C:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 D:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 E:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 F:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 G:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 H:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 I:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 J:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 K:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 L:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 M:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 N:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 O:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 P:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 Q:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 R:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 S:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 T:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 a:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 b:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 c:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 d:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 e:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 f:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 g:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 h:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 i:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 j:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 k:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 l:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 m:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 n:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 o:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 p:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 q:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 r:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 s:261-336 X-RAY DIFFRACTION 3.18

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4RO0 t:261-336 X-RAY DIFFRACTION 3.18
Representative CF domain (8001555)
Calcium-gated potassium channel mthK

Methanothermobacter thermautotrophicus (145262)

 O27564 261-336

Derived from SCOP domain 134346
rasmol icon 2FY8 A:261-336 X-RAY DIFFRACTION 2.79
Clustered domains rasmol icon 1LNQ A:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ B:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ C:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ D:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ E:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ F:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ G:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 1LNQ H:261-336 X-RAY DIFFRACTION 3.30
rasmol icon 2AEF A:261-336 X-RAY DIFFRACTION 1.7
rasmol icon 2AEF B:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 1.7
rasmol icon 2AEJ A:261-336 X-RAY DIFFRACTION 2.1
rasmol icon 2AEJ B:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.1
rasmol icon 2AEM A:261-336 X-RAY DIFFRACTION 2.8
rasmol icon 2FY8 B:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 C:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 D:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 E:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 F:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 G:261-336 X-RAY DIFFRACTION 2.79
rasmol icon 2FY8 H:261-336 X-RAY DIFFRACTION 2.79

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 2OGU A:261-336 X-RAY DIFFRACTION 3.23

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD A:261-336 X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3KXD B:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.20

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX A:261-336 X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX B:261-336 X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX C:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX D:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX E:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBX F:261-334 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ A:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ B:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ C:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 3RBZ D:261-336 X-RAY DIFFRACTION 3.4

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 A:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 B:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 C:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 D:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 E:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 F:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 G:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 H:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 I:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 J:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 K:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 L:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 M:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 N:261-336 X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 O:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4EI2 P:261-335 The ends of this domain were trimmed X-RAY DIFFRACTION 3.108

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 A:261-336 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L73 B:261-336 X-RAY DIFFRACTION 2.500

Methanothermobacter thermautotrophicus str. Delta H (187420)

rasmol icon 4L74 A:261-336 X-RAY DIFFRACTION 1.841

Methanothermobacter thermautotrophicus str. Delta H (