Representative Sequence

SPROT P15498

Proto-oncogene vav (20147)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINI EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLAL DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQ GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF YQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVH GPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGS TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED YSEYC 60
120
180
240
300
360
420
480
540
600
660
720
780
840
845

Domains PDB ID RegionMethodResolution
Representative PR domain (8018806)
Proto-oncogene vav

Homo sapiens (9606)

 P15498 2-565

rasmol icon 3KY9 B:2-565 X-RAY DIFFRACTION 2.731
Clustered domains rasmol icon 3BJI A:189-565 The ends of this domain were trimmed X-RAY DIFFRACTION 2.60
rasmol icon 3BJI B:189-565 The ends of this domain were trimmed X-RAY DIFFRACTION 2.60
rasmol icon 3KY9 A:2-564 Some residues were not observed X-RAY DIFFRACTION 2.731
Representative PR domain (8018807)
Proto-oncogene vav

Homo sapiens (9606)

 P15498 664-767

rasmol icon 2LCT A:664-767 SOLUTION NMR n/a
Clustered domains rasmol icon 2CRH A:21-124 SOLUTION NMR n/a
rasmol icon 2MC1 A:664-767 SOLUTION NMR n/a
rasmol icon 2ROR A:21-124 SOLUTION NMR n/a
Representative FA domain (8018844)
Proto-oncogene vav

Homo sapiens (9606)

 P15498 2-124

rasmol icon 3KY9 B:2-124 X-RAY DIFFRACTION 2.731
Clustered domains rasmol icon 3KY9 A:2-124 X-RAY DIFFRACTION 2.731
Representative FA domain (8018845)
Proto-oncogene vav

Homo sapiens (9606)

 P15498 664-767

rasmol icon 2LCT A:664-767 SOLUTION NMR n/a
Clustered domains rasmol icon 2CRH A:21-124 SOLUTION NMR n/a
rasmol icon 2MC1 A:664-767 SOLUTION NMR n/a
rasmol icon 2ROR A:21-124 SOLUTION NMR n/a
Representative FA domain (8018846)
Proto-oncogene vav

Homo sapiens (9606)

 P15498 168-373

rasmol icon 3KY9 B:168-373 X-RAY DIFFRACTION 2.731
Clustered domains rasmol icon 3BJI A:189-373 The ends of this domain were trimmed X-RAY DIFFRACTION 2.60
rasmol icon 3BJI B:189-373 The ends of this domain were trimmed X-RAY DIFFRACTION 2.60
rasmol icon 3KY9 A:168-373 X-RAY DIFFRACTION 2.731
Representative FA domain (8018851)
Proto-oncogene vav

Homo sapiens (9606)

 P15498 403-508

rasmol icon 3KY9 B:403-508 X-RAY DIFFRACTION 2.731
Clustered domains rasmol icon 3BJI A:403-508 X-RAY DIFFRACTION 2.60
rasmol icon 3BJI B:403-508 X-RAY DIFFRACTION 2.60
rasmol icon 3KY9 A:403-508 X-RAY DIFFRACTION 2.731
Representative FA domain (8018854)
Proto-oncogene vav

Homo sapiens (9606)

 P15498 512-565

rasmol icon 3KY9 B:512-565 X-RAY DIFFRACTION 2.731
Clustered domains rasmol icon 3BJI A:512-565 X-RAY DIFFRACTION 2.60
rasmol icon 3BJI B:512-565 X-RAY DIFFRACTION 2.60
rasmol icon 3KY9 A:512-564 The ends of this domain were trimmed X-RAY DIFFRACTION 2.731