Representative Sequence

SPROT Q8WXF7

Atlastin-1 (21555)

1
61
121
181
241
301
361
421
481
541
MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSE AVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWVGDYNEPLTGFSWRGGSERET TGIQIWSEIFLINKPDGKKVAVLLMDTQGTFDSQSTLRDSATVFALSTMISSIQVYNLSQ NVQEDDLQHLQLFTEYGRLAMEETFLKPFQSLIFLVRDWSFPYEFSYGADGGAKFLEKRL KVSGNQHEELQNVRKHIHSCFTNISCFLLPHPGLKVATNPNFDGKLKEIDDEFIKNLKIL IPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAV ATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQ LESEIDELYIQYIKHNDSKNIFHAARTPATLFVVIFITYVIAGVTGFIGLDIIASLCNMI MGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQ AFPTPKSESTEQSEKKKM 60
120
180
240
300
360
420
480
540
558

Domains PDB ID RegionMethodResolution
Representative PR domain (8019675)
Atlastin-1

Homo sapiens (9606)

 Q8WXF7 29-438

rasmol icon 3Q5D A:29-438 X-RAY DIFFRACTION 2.699
Clustered domains rasmol icon 3Q5E A:30-438 The ends of this domain were trimmed X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E C:30-438 The ends of this domain were trimmed X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E E:30-438 Some residues were not observed X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E G:30-438 Some residues were not observed X-RAY DIFFRACTION 3.013
rasmol icon 3QNU A:31-434 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800
rasmol icon 3QOF A:31-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 3QOF B:31-432 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 3QOF C:31-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 3QOF D:31-432 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 4IDN A:30-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.252
rasmol icon 4IDN B:31-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.252
rasmol icon 4IDO A:31-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.091
rasmol icon 4IDO B:31-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.091
rasmol icon 4IDP A:31-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.587
rasmol icon 4IDP B:31-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.587
rasmol icon 4IDP C:31-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.587
rasmol icon 4IDP D:30-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.587
rasmol icon 4IDQ A:30-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ B:30-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ C:30-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ D:30-438 The ends of this domain were trimmed X-RAY DIFFRACTION 2.295
Representative FA domain (8019676)
Atlastin-1

Homo sapiens (9606)

 Q8WXF7 29-341

rasmol icon 3Q5D A:29-341 X-RAY DIFFRACTION 2.699
Clustered domains rasmol icon 3Q5E A:30-341 The ends of this domain were trimmed X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E C:30-341 The ends of this domain were trimmed X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E E:30-341 Some residues were not observed X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E G:30-341 Some residues were not observed X-RAY DIFFRACTION 3.013
rasmol icon 3QNU A:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800
rasmol icon 3QOF A:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 3QOF B:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 3QOF C:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 3QOF D:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 4IDN A:30-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.252
rasmol icon 4IDN B:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.252
rasmol icon 4IDO A:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.091
rasmol icon 4IDO B:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.091
rasmol icon 4IDP A:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.587
rasmol icon 4IDP B:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.587
rasmol icon 4IDP C:31-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.587
rasmol icon 4IDP D:30-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.587
rasmol icon 4IDQ A:30-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ B:30-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ C:30-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ D:30-341 The ends of this domain were trimmed X-RAY DIFFRACTION 2.295
Representative FA domain (8019677)
Atlastin-1

Homo sapiens (9606)

 Q8WXF7 345-438

rasmol icon 3Q5D A:345-438 X-RAY DIFFRACTION 2.699
Clustered domains rasmol icon 3Q5E A:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E C:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E E:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E G:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3QNU A:345-434 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800
rasmol icon 3QOF A:345-438 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF B:345-432 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 3QOF C:345-438 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF D:345-432 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 4IDN A:345-438 X-RAY DIFFRACTION 2.252
rasmol icon 4IDN B:345-438 X-RAY DIFFRACTION 2.252
rasmol icon 4IDO A:345-438 X-RAY DIFFRACTION 2.091
rasmol icon 4IDO B:345-438 X-RAY DIFFRACTION 2.091
rasmol icon 4IDP A:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP B:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP C:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP D:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDQ A:345-438 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ B:345-438 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ C:345-438 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ D:345-438 X-RAY DIFFRACTION 2.295
Representative SF domain (8019678)
Atlastin-1

Homo sapiens (9606)

 Q8WXF7 345-438

rasmol icon 3Q5D A:345-438 X-RAY DIFFRACTION 2.699
Clustered domains rasmol icon 3Q5E A:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E C:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E E:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E G:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3QNU A:345-434 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800
rasmol icon 3QOF A:345-438 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF B:345-432 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 3QOF C:345-438 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF D:345-432 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 4IDN A:345-438 X-RAY DIFFRACTION 2.252
rasmol icon 4IDN B:345-438 X-RAY DIFFRACTION 2.252
rasmol icon 4IDO A:345-438 X-RAY DIFFRACTION 2.091
rasmol icon 4IDO B:345-438 X-RAY DIFFRACTION 2.091
rasmol icon 4IDP A:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP B:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP C:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP D:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDQ A:345-438 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ B:345-438 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ C:345-438 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ D:345-438 X-RAY DIFFRACTION 2.295
Representative CF domain (8019679)
Atlastin-1

Homo sapiens (9606)

 Q8WXF7 345-438

rasmol icon 3Q5D A:345-438 X-RAY DIFFRACTION 2.699
Clustered domains rasmol icon 3Q5E A:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E C:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E E:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E G:345-438 X-RAY DIFFRACTION 3.013
rasmol icon 3QNU A:345-434 The ends of this domain were trimmed X-RAY DIFFRACTION 2.800
rasmol icon 3QOF A:345-438 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF B:345-432 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 3QOF C:345-438 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF D:345-432 The ends of this domain were trimmed X-RAY DIFFRACTION 2.802
rasmol icon 4IDN A:345-438 X-RAY DIFFRACTION 2.252
rasmol icon 4IDN B:345-438 X-RAY DIFFRACTION 2.252
rasmol icon 4IDO A:345-438 X-RAY DIFFRACTION 2.091
rasmol icon 4IDO B:345-438 X-RAY DIFFRACTION 2.091
rasmol icon 4IDP A:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP B:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP C:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP D:345-438 X-RAY DIFFRACTION 2.587
rasmol icon 4IDQ A:345-438 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ B:345-438 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ C:345-438 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ D:345-438 X-RAY DIFFRACTION 2.295
Representative SF domain (8019680)
Atlastin-1

Homo sapiens (9606)

 Q8WXF7 65-307

rasmol icon 3Q5D A:65-307 X-RAY DIFFRACTION 2.699
Clustered domains rasmol icon 3Q5E A:65-307 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E C:65-307 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E E:65-307 Some residues were not observed X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E G:65-307 Some residues were not observed X-RAY DIFFRACTION 3.013
rasmol icon 3QNU A:65-307 X-RAY DIFFRACTION 2.800
rasmol icon 3QOF A:65-307 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF B:65-307 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF C:65-307 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF D:65-307 X-RAY DIFFRACTION 2.802
rasmol icon 4IDN A:65-307 X-RAY DIFFRACTION 2.252
rasmol icon 4IDN B:65-307 X-RAY DIFFRACTION 2.252
rasmol icon 4IDO A:65-307 X-RAY DIFFRACTION 2.091
rasmol icon 4IDO B:65-307 X-RAY DIFFRACTION 2.091
rasmol icon 4IDP A:65-307 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP B:65-307 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP C:65-307 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP D:65-307 X-RAY DIFFRACTION 2.587
rasmol icon 4IDQ A:65-307 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ B:65-307 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ C:65-307 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ D:65-307 X-RAY DIFFRACTION 2.295
Representative CF domain (8019681)
Atlastin-1

Homo sapiens (9606)

 Q8WXF7 65-307

rasmol icon 3Q5D A:65-307 X-RAY DIFFRACTION 2.699
Clustered domains rasmol icon 3Q5E A:65-307 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E C:65-307 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E E:65-307 Some residues were not observed X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E G:65-307 Some residues were not observed X-RAY DIFFRACTION 3.013
rasmol icon 3QNU A:65-307 X-RAY DIFFRACTION 2.800
rasmol icon 3QOF A:65-307 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF B:65-307 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF C:65-307 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF D:65-307 X-RAY DIFFRACTION 2.802
rasmol icon 4IDN A:65-307 X-RAY DIFFRACTION 2.252
rasmol icon 4IDN B:65-307 X-RAY DIFFRACTION 2.252
rasmol icon 4IDO A:65-307 X-RAY DIFFRACTION 2.091
rasmol icon 4IDO B:65-307 X-RAY DIFFRACTION 2.091
rasmol icon 4IDP A:65-307 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP B:65-307 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP C:65-307 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP D:65-307 X-RAY DIFFRACTION 2.587
rasmol icon 4IDQ A:65-307 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ B:65-307 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ C:65-307 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ D:65-307 X-RAY DIFFRACTION 2.295
Representative HF domain (8019682)
Atlastin-1

Homo sapiens (9606)

 Q8WXF7 65-180

rasmol icon 3Q5D A:65-180 X-RAY DIFFRACTION 2.699
Clustered domains rasmol icon 3Q5E A:65-180 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E C:65-180 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E E:65-180 X-RAY DIFFRACTION 3.013
rasmol icon 3Q5E G:65-180 X-RAY DIFFRACTION 3.013
rasmol icon 3QNU A:65-180 X-RAY DIFFRACTION 2.800
rasmol icon 3QOF A:65-180 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF B:65-180 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF C:65-180 X-RAY DIFFRACTION 2.802
rasmol icon 3QOF D:65-180 X-RAY DIFFRACTION 2.802
rasmol icon 4IDN A:65-180 X-RAY DIFFRACTION 2.252
rasmol icon 4IDN B:65-180 X-RAY DIFFRACTION 2.252
rasmol icon 4IDO A:65-180 X-RAY DIFFRACTION 2.091
rasmol icon 4IDO B:65-180 X-RAY DIFFRACTION 2.091
rasmol icon 4IDP A:65-180 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP B:65-180 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP C:65-180 X-RAY DIFFRACTION 2.587
rasmol icon 4IDP D:65-180 X-RAY DIFFRACTION 2.587
rasmol icon 4IDQ A:65-180 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ B:65-180 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ C:65-180 X-RAY DIFFRACTION 2.295
rasmol icon 4IDQ D:65-180 X-RAY DIFFRACTION 2.295