Representative Sequence

SPROT Q9WZ12

Malate oxidoreductase (2162)

1
61
121
181
241
301
361
MDALEIHRFLKGKIRTALPVEKVDRETLSLLYTPGVADVARACAEDPEKTYVYTSRWNTV AVVSDGSAVLGLGNIGPYGALPVMEGKAFLFKAFADIDAFPICLSESEEEKIISIVKSLE PSFGGINLEDIGAPKCFRILQRLSEEMNIPVFHDDQQGTAVVVSAAFLNALKLTEKKIEE VKVVVNGIGAAGYNIVKFLLDLGVKNVVAVDRKGILNENDPETCLNEYHLEIARITNPER LSGDLETALEGADFFIGVSRGNILKPEWIKKMSRKPVIFALANPVPEIDPELAREAGAFI VATGRSDHPNQVNNLLAFPGIMKGAVEKRSKITKNMLLSAVEAIARSCEPEPERIIPEAF DMKVHLNVYTAVKGSA 60
120
180
240
300
360
376

Domains PDB ID RegionMethodResolution
Representative SP domain (8001069)
Malate oxidoreductase

Thermotoga maritima MSB8 (243274)

 Q9WZ12 2-376

Derived from SCOP domain 108724
rasmol icon 1VL6 A:2-376 X-RAY DIFFRACTION 2.61
Clustered domains rasmol icon 1VL6 B:2-376 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 C:2-376 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 D:2-376 X-RAY DIFFRACTION 2.61

Thermotoga maritima (2336)

rasmol icon 2HAE A:2-376 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE B:2-376 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE C:2-376 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE D:2-376 Some residues were not observed X-RAY DIFFRACTION 3.13
Representative PR domain (8001070)
Malate oxidoreductase

Thermotoga maritima MSB8 (243274)

 Q9WZ12 2-376

Derived from SCOP domain 108724
rasmol icon 1VL6 A:2-376 X-RAY DIFFRACTION 2.61
Clustered domains rasmol icon 1VL6 B:2-376 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 C:2-376 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 D:2-376 X-RAY DIFFRACTION 2.61

Thermotoga maritima (2336)

rasmol icon 2HAE A:2-376 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE B:2-376 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE C:2-376 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE D:2-376 Some residues were not observed X-RAY DIFFRACTION 3.13
Representative FA domain (8001071)
Malate oxidoreductase

Thermotoga maritima MSB8 (243274)

 Q9WZ12 2-376

Derived from SCOP domain 108724
rasmol icon 1VL6 A:2-376 X-RAY DIFFRACTION 2.61
Clustered domains rasmol icon 1VL6 B:2-376 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 C:2-376 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 D:2-376 X-RAY DIFFRACTION 2.61

Thermotoga maritima (2336)

rasmol icon 2HAE A:2-376 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE B:2-376 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE C:2-376 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE D:2-376 Some residues were not observed X-RAY DIFFRACTION 3.13
Representative SF domain (8001072)
Malate oxidoreductase

Thermotoga maritima MSB8 (243274)

 Q9WZ12 58-329

Derived from SCOP domain 108724
rasmol icon 1VL6 A:58-329 X-RAY DIFFRACTION 2.61
Clustered domains rasmol icon 1VL6 B:58-329 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 C:58-329 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 D:58-329 X-RAY DIFFRACTION 2.61

Thermotoga maritima (2336)

rasmol icon 2HAE A:58-329 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE B:58-329 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE C:58-329 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE D:58-329 Some residues were not observed X-RAY DIFFRACTION 3.13
Representative HF domain (8001073)
Malate oxidoreductase

Thermotoga maritima MSB8 (243274)

 Q9WZ12 180-304

Derived from SCOP domain 108724
rasmol icon 1VL6 A:180-304 X-RAY DIFFRACTION 2.61
Clustered domains rasmol icon 1VL6 B:180-304 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 C:180-304 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 D:180-304 X-RAY DIFFRACTION 2.61

Thermotoga maritima (2336)

rasmol icon 2HAE A:180-304 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE B:180-304 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE C:180-304 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE D:180-304 Some residues were not observed X-RAY DIFFRACTION 3.13
Representative CF domain (8001074)
Malate oxidoreductase

Thermotoga maritima MSB8 (243274)

 Q9WZ12 58-154

Derived from SCOP domain 108725
rasmol icon 1VL6 A:58-154 X-RAY DIFFRACTION 2.61
Clustered domains rasmol icon 1VL6 B:58-154 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 C:58-154 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 D:58-154 X-RAY DIFFRACTION 2.61

Thermotoga maritima (2336)

rasmol icon 2HAE A:58-154 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE B:58-154 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE C:58-154 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE D:58-154 X-RAY DIFFRACTION 3.13
Representative IR domain (8001277)
Malate oxidoreductase

Thermotoga maritima MSB8 (243274)

 Q9WZ12 181-213

Derived from SCOP domain 108724
rasmol icon 1VL6 A:181-213 X-RAY DIFFRACTION 2.61
Clustered domains rasmol icon 1VL6 B:181-213 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 C:181-213 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 D:181-213 X-RAY DIFFRACTION 2.61

Thermotoga maritima (2336)

rasmol icon 2HAE A:181-213 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE B:181-213 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE C:181-213 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE D:181-213 X-RAY DIFFRACTION 3.13
Representative CF domain (8004344)
Malate oxidoreductase

Thermotoga maritima MSB8 (243274)

 Q9WZ12 180-304

Derived from SCOP domain 108724
rasmol icon 1VL6 A:180-304 X-RAY DIFFRACTION 2.61
Clustered domains rasmol icon 1VL6 B:180-304 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 C:180-304 X-RAY DIFFRACTION 2.61
rasmol icon 1VL6 D:180-304 X-RAY DIFFRACTION 2.61

Thermotoga maritima (2336)

rasmol icon 2HAE A:180-304 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE B:180-304 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE C:180-304 X-RAY DIFFRACTION 3.13

Thermotoga maritima (2336)

rasmol icon 2HAE D:180-304 Some residues were not observed X-RAY DIFFRACTION 3.13