Representative Sequence

SPROT P68403

Protein kinase C beta type (22015)

1
61
121
181
241
301
361
421
481
541
601
661
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDA KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE LRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF SYTNPEFVINV 60
120
180
240
300
360
420
480
540
600
660
671

Domains PDB ID RegionMethodResolution
Representative PR domain (8018907)
Protein kinase C beta type

Rattus norvegicus (10116)

 P68403 102-668

Derived from SCOP domain 23197
rasmol icon 3PFQ A:101-668 missing exptl_method missing resolution
Clustered domains rasmol icon 1A25 A:155-288 The ends of this domain were trimmed X-RAY DIFFRACTION 2.70
rasmol icon 1A25 B:155-288 The ends of this domain were trimmed X-RAY DIFFRACTION 2.70
Representative FA domain (8018908)
Protein kinase C beta type

Rattus norvegicus (10116)

 P68403 158-289

Derived from SCOP domain 23197
rasmol icon 3PFQ A:157-288 missing exptl_method missing resolution
Clustered domains rasmol icon 1A25 A:158-288 The ends of this domain were trimmed X-RAY DIFFRACTION 2.70
rasmol icon 1A25 B:158-288 The ends of this domain were trimmed X-RAY DIFFRACTION 2.70
Representative FA domain (8018909)
Protein kinase C beta type

Rattus norvegicus (10116)

 P68403 102-153

Derived from SCOP domain 23197
rasmol icon 3PFQ A:101-152 missing exptl_method missing resolution
Representative FA domain (8018910)
Protein kinase C beta type

Rattus norvegicus (10116)

 P68403 342-668

Derived from SCOP domain 23197
rasmol icon 3PFQ A:341-668 missing exptl_method missing resolution