Representative Sequence

SPROT P09147

UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase) (2250)

1
61
121
181
241
301
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIR NEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFI FSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNP VGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLA DGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYW ADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD 60
120
180
240
300
338

Domains PDB ID RegionMethodResolution
Representative SP domain (8000196)
UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase)
complexed with edo, na, nad, pig, ufm

Escherichia coli (562)

 P09147 1-338

Derived from SCOP domain 29785
rasmol icon 1UDC A:1-338 X-RAY DIFFRACTION 1.65
Clustered domains rasmol icon 1A9Y A:1-338 X-RAY DIFFRACTION 1.8
rasmol icon 1A9Z A:1-338 X-RAY DIFFRACTION 1.9
rasmol icon 1KVQ A:1-338 X-RAY DIFFRACTION 2.15
rasmol icon 1KVR A:1-338 X-RAY DIFFRACTION 1.90
rasmol icon 1KVS A:1-338 X-RAY DIFFRACTION 2.15
rasmol icon 1KVT A:1-338 X-RAY DIFFRACTION 2.15
rasmol icon 1KVU A:1-338 X-RAY DIFFRACTION 1.90
rasmol icon 1LRJ A:1-338 X-RAY DIFFRACTION 1.90
rasmol icon 1LRK A:1-338 X-RAY DIFFRACTION 1.75
rasmol icon 1LRL A:1-338 X-RAY DIFFRACTION 1.80
rasmol icon 1NAH A:1-338 X-RAY DIFFRACTION 1.8
rasmol icon 1NAI A:1-338 X-RAY DIFFRACTION 2.0
rasmol icon 1UDA A:1-338 X-RAY DIFFRACTION 1.80
rasmol icon 1UDB A:1-338 X-RAY DIFFRACTION 1.65
rasmol icon 1XEL A:1-338 X-RAY DIFFRACTION 1.8
rasmol icon 2UDP A:1-338 X-RAY DIFFRACTION 1.80
rasmol icon 2UDP B:1-338 X-RAY DIFFRACTION 1.80

Escherichia coli K-12 (83333)

rasmol icon 5GY7 A:1-338 X-RAY DIFFRACTION 1.43

Escherichia coli K-12 (83333)

rasmol icon 5GY7 B:1-338 X-RAY DIFFRACTION 1.43
Representative PR domain (8000692)
UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase)
complexed with edo, na, nad, pig, ufm

Escherichia coli (562)

 P09147 1-338

Derived from SCOP domain 29785
rasmol icon 1UDC A:1-338 X-RAY DIFFRACTION 1.65
Clustered domains rasmol icon 1A9Y A:1-338 X-RAY DIFFRACTION 1.8
rasmol icon 1A9Z A:1-338 X-RAY DIFFRACTION 1.9
rasmol icon 1KVQ A:1-338 X-RAY DIFFRACTION 2.15
rasmol icon 1KVR A:1-338 X-RAY DIFFRACTION 1.90
rasmol icon 1KVS A:1-338 X-RAY DIFFRACTION 2.15
rasmol icon 1KVT A:1-338 X-RAY DIFFRACTION 2.15
rasmol icon 1KVU A:1-338 X-RAY DIFFRACTION 1.90
rasmol icon 1LRJ A:1-338 X-RAY DIFFRACTION 1.90
rasmol icon 1LRK A:1-338 X-RAY DIFFRACTION 1.75
rasmol icon 1LRL A:1-338 X-RAY DIFFRACTION 1.80
rasmol icon 1NAH A:1-338 X-RAY DIFFRACTION 1.8
rasmol icon 1NAI A:1-338 X-RAY DIFFRACTION 2.0
rasmol icon 1UDA A:1-338 X-RAY DIFFRACTION 1.80
rasmol icon 1UDB A:1-338 X-RAY DIFFRACTION 1.65
rasmol icon 1XEL A:1-338 X-RAY DIFFRACTION 1.8
rasmol icon 2UDP A:1-338 X-RAY DIFFRACTION 1.80
rasmol icon 2UDP B:1-338 X-RAY DIFFRACTION 1.80

Escherichia coli K-12 (83333)

rasmol icon 5GY7 A:1-338 X-RAY DIFFRACTION 1.43

Escherichia coli K-12 (83333)

rasmol icon 5GY7 B:1-338 X-RAY DIFFRACTION 1.43
Representative FA domain (8000693)
UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase)
complexed with edo, na, nad, pig, ufm

Escherichia coli (562)

 P09147 1-338

Derived from SCOP domain 29785
rasmol icon 1UDC A:1-338 X-RAY DIFFRACTION 1.65
Clustered domains rasmol icon 1A9Y A:1-338 X-RAY DIFFRACTION 1.8
rasmol icon 1A9Z A:1-338 X-RAY DIFFRACTION 1.9
rasmol icon 1KVQ A:1-338 X-RAY DIFFRACTION 2.15
rasmol icon 1KVR A:1-338 X-RAY DIFFRACTION 1.90
rasmol icon 1KVS A:1-338 X-RAY DIFFRACTION 2.15
rasmol icon 1KVT A:1-338 X-RAY DIFFRACTION 2.15
rasmol icon 1KVU A:1-338 X-RAY DIFFRACTION 1.90
rasmol icon 1LRJ A:1-338 X-RAY DIFFRACTION 1.90
rasmol icon 1LRK A:1-338 X-RAY DIFFRACTION 1.75
rasmol icon 1LRL A:1-338 X-RAY DIFFRACTION 1.80
rasmol icon 1NAH A:1-338 X-RAY DIFFRACTION 1.8
rasmol icon 1NAI A:1-338 X-RAY DIFFRACTION 2.0
rasmol icon 1UDA A:1-338 X-RAY DIFFRACTION 1.80
rasmol icon 1UDB A:1-338 X-RAY DIFFRACTION 1.65
rasmol icon 1XEL A:1-338 X-RAY DIFFRACTION 1.8
rasmol icon 2UDP A:1-338 X-RAY DIFFRACTION 1.80
rasmol icon 2UDP B:1-338 X-RAY DIFFRACTION 1.80

Escherichia coli K-12 (83333)

rasmol icon 5GY7 A:1-338 X-RAY DIFFRACTION 1.43

Escherichia coli K-12 (83333)

rasmol icon 5GY7 B:1-338 X-RAY DIFFRACTION 1.43
Representative SF domain (8000694)
UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase)
complexed with edo, na, nad, pig, ufm

Escherichia coli (562)

 P09147 1-263

Derived from SCOP domain 29785
rasmol icon 1UDC A:1-263 X-RAY DIFFRACTION 1.65
Clustered domains rasmol icon 1A9Y A:1-263 X-RAY DIFFRACTION 1.8
rasmol icon 1A9Z A:1-263 X-RAY DIFFRACTION 1.9
rasmol icon 1KVQ A:1-263 X-RAY DIFFRACTION 2.15
rasmol icon 1KVR A:1-263 X-RAY DIFFRACTION 1.90
rasmol icon 1KVS A:1-263 X-RAY DIFFRACTION 2.15
rasmol icon 1KVT A:1-263 X-RAY DIFFRACTION 2.15
rasmol icon 1KVU A:1-263 X-RAY DIFFRACTION 1.90
rasmol icon 1LRJ A:1-263 X-RAY DIFFRACTION 1.90
rasmol icon 1LRK A:1-263 X-RAY DIFFRACTION 1.75
rasmol icon 1LRL A:1-263 X-RAY DIFFRACTION 1.80
rasmol icon 1NAH A:1-263 X-RAY DIFFRACTION 1.8
rasmol icon 1NAI A:1-263 X-RAY DIFFRACTION 2.0
rasmol icon 1UDA A:1-263 X-RAY DIFFRACTION 1.80
rasmol icon 1UDB A:1-263 X-RAY DIFFRACTION 1.65
rasmol icon 1XEL A:1-263 X-RAY DIFFRACTION 1.8
rasmol icon 2UDP A:1-263 X-RAY DIFFRACTION 1.80
rasmol icon 2UDP B:1-263 X-RAY DIFFRACTION 1.80

Escherichia coli K-12 (83333)

rasmol icon 5GY7 A:1-263 X-RAY DIFFRACTION 1.43

Escherichia coli K-12 (83333)

rasmol icon 5GY7 B:1-263 X-RAY DIFFRACTION 1.43
Representative HF domain (8000695)
UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase)
complexed with edo, na, nad, pig, ufm

Escherichia coli (562)

 P09147 1-179

Derived from SCOP domain 29785
rasmol icon 1UDC A:1-179 X-RAY DIFFRACTION 1.65
Clustered domains rasmol icon 1A9Y A:1-179 X-RAY DIFFRACTION 1.8
rasmol icon 1A9Z A:1-179 X-RAY DIFFRACTION 1.9
rasmol icon 1KVQ A:1-179 X-RAY DIFFRACTION 2.15
rasmol icon 1KVR A:1-179 X-RAY DIFFRACTION 1.90
rasmol icon 1KVS A:1-179 X-RAY DIFFRACTION 2.15
rasmol icon 1KVT A:1-179 X-RAY DIFFRACTION 2.15
rasmol icon 1KVU A:1-179 X-RAY DIFFRACTION 1.90
rasmol icon 1LRJ A:1-179 X-RAY DIFFRACTION 1.90
rasmol icon 1LRK A:1-179 X-RAY DIFFRACTION 1.75
rasmol icon 1LRL A:1-179 X-RAY DIFFRACTION 1.80
rasmol icon 1NAH A:1-179 X-RAY DIFFRACTION 1.8
rasmol icon 1NAI A:1-179 X-RAY DIFFRACTION 2.0
rasmol icon 1UDA A:1-179 X-RAY DIFFRACTION 1.80
rasmol icon 1UDB A:1-179 X-RAY DIFFRACTION 1.65
rasmol icon 1XEL A:1-179 X-RAY DIFFRACTION 1.8
rasmol icon 2UDP A:1-179 X-RAY DIFFRACTION 1.80
rasmol icon 2UDP B:1-179 X-RAY DIFFRACTION 1.80

Escherichia coli K-12 (83333)

rasmol icon 5GY7 A:1-179 X-RAY DIFFRACTION 1.43

Escherichia coli K-12 (83333)

rasmol icon 5GY7 B:1-179 X-RAY DIFFRACTION 1.43
Representative CF domain (8004315)
UDP-glucose 4-epimerase (EC 51.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase)
complexed with edo, na, nad, pig, ufm

Escherichia coli (562)

 P09147 1-263

Derived from SCOP domain 29785
rasmol icon 1UDC A:1-263 X-RAY DIFFRACTION 1.65
Clustered domains rasmol icon 1A9Y A:1-263 X-RAY DIFFRACTION 1.8
rasmol icon 1A9Z A:1-263 X-RAY DIFFRACTION 1.9
rasmol icon 1KVQ A:1-263 X-RAY DIFFRACTION 2.15
rasmol icon 1KVR A:1-263 X-RAY DIFFRACTION 1.90
rasmol icon 1KVS A:1-263 X-RAY DIFFRACTION 2.15
rasmol icon 1KVT A:1-263 X-RAY DIFFRACTION 2.15
rasmol icon 1KVU A:1-263 X-RAY DIFFRACTION 1.90
rasmol icon 1LRJ A:1-263 X-RAY DIFFRACTION 1.90
rasmol icon 1LRK A:1-263 X-RAY DIFFRACTION 1.75
rasmol icon 1LRL A:1-263 X-RAY DIFFRACTION 1.80
rasmol icon 1NAH A:1-263 X-RAY DIFFRACTION 1.8
rasmol icon 1NAI A:1-263 X-RAY DIFFRACTION 2.0
rasmol icon 1UDA A:1-263 X-RAY DIFFRACTION 1.80
rasmol icon 1UDB A:1-263 X-RAY DIFFRACTION 1.65
rasmol icon 1XEL A:1-263 X-RAY DIFFRACTION 1.8
rasmol icon 2UDP A:1-263 X-RAY DIFFRACTION 1.80
rasmol icon 2UDP B:1-263 X-RAY DIFFRACTION 1.80

Escherichia coli K-12 (83333)

rasmol icon 5GY7 A:1-263 X-RAY DIFFRACTION 1.43

Escherichia coli K-12 (83333)

rasmol icon 5GY7 B:1-263 X-RAY DIFFRACTION 1.43