Representative Sequence

SPROT P20964

GTPase obgE (23494)

1
61
121
181
241
301
361
421
MFVDQVKVYVKGGDGGNGMVAFRREKYVPKGGPAGGDGGKGGDVVFEVDEGLRTLMDFRY KKHFKAIRGEHGMSKNQHGRNADDMVIKVPPGTVVTDDDTKQVIADLTEHGQRAVIARGG RGGRGNSRFATPANPAPQLSENGEPGKERYIVLELKVLADVGLVGFPSVGKSTLLSVVSS AKPKIADYHFTTLVPNLGMVETDDGRSFVMADLPGLIEGAHQGVGLGHQFLRHIERTRVI VHVIDMSGLEGRDPYDDYLTINQELSEYNLRLTERPQIIVANKMDMPEAAENLEAFKEKL TDDYPVFPISAVTREGLRELLFEVANQLENTPEFPLYDEEELTQNRVMYTMENEEVPFNI TRDPDGVFVLSGDSLERLFKMTDFSRDESVKRFARQMRGMGVDEALRERGAKDGDIIRLL EFEFEFID 60
120
180
240
300
360
420
428

Domains PDB ID RegionMethodResolution
Representative PR domain (8019358)
GTPase obgE

Bacillus subtilis (1423)

 P20964 2-342

Derived from SCOP domain 78113
rasmol icon 1LNZ A:2-342 X-RAY DIFFRACTION 2.60
Clustered domains rasmol icon 1LNZ B:2-337 Some residues were not observed X-RAY DIFFRACTION 2.60