Representative Sequence

SPROT P21359

Neurofibromin (23772)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
1441
1501
1561
1621
1681
1741
1801
1861
1921
1981
2041
2101
2161
2221
2281
2341
2401
2461
2521
2581
2641
2701
2761
2821
MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTT ILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHF LHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELL QYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQT DMAECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDENNMNKKLFL DSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNP SKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITN SALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTSLKFKEK PTDLETRSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGSTAELITGLVQLVPQSHMPE IAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEILKWL REILICRNKFLLKNKQADRSSCHFLLFYGVGCDIPSSGNTSQMSMDHEELLRTPGASLRK GKGNSSMDSAAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCEEADIR CGVDEVSVHNLLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPTAGNTEAWEDT HAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINM TGFLCALGGVCLQQRSNSGLATYSPPMGPVSERKGSMISVMSSEGNADTPVSKFMDRLLS LMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQF VEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHAIQIKTKLCQLVE VMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDLDQASMEAVVSLL AGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDESAQTGGRKRGMSRRLAS LRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETV LADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNM FSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVITSSDWQHVSFE VDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPPQLRSVCHCLYQATCHSLLNKA TVKEKKENKKSVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLK LMSKILQSIANHVLFTKEEHMRPFNDFVKSNFDAARRFFLDIASDCPTSDAVNHSLSFIS DGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPEHKPVADTHWS SLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVARRFKTGQING DLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIY NCNSWVREYTKYHERLLTGLKGSKRLVFIDCPGKLAEHIEHEQQKLPAATLALEEDLKVF HNALKLAHKDTKVSIKVGSTAVQVTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQFT LTIANQGTPLTFMHQECEAIVQSIIHIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIALL NLGSSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAANEP HLTLEFLEECISGFSKSSIELKHLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLIT MTINEKQMYPSIQAKIWGSLGQITDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVALAS GNVKLVSSKVIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHL PYLFHVVTFLVATGPLSLRASTHGLVINIIHSLCTCSQLHFSEETKQVLRLSLTEFSLPK FYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALTSLETVTEALLEIMEACMRDI PTCKWLDQWTELAQRFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRILSKALESCLK GPDTYNSQVLIEATVIALTKLQPLLNKDSPLHKALFWVAVAVLQLDEVNLYSAGTALLEQ NLHTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGYRH PSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHRKS LLLTDISMENVPMDTYPIHHGDPSYRTLKETQPWSSPKGSEGYLAATYPTVGQTSPRARK SMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEME TQRISSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRILY EYLAEASVVFPKVFPVVHNLLDSKINTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQT SYLQSFGFNGLWRFAGPFSKQTQIPDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTS PYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQ VQKQRSAGSFKRNSIKKIV 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1260
1320
1380
1440
1500
1560
1620
1680
1740
1800
1860
1920
1980
2040
2100
2160
2220
2280
2340
2400
2460
2520
2580
2640
2700
2760
2820
2839

Domains PDB ID RegionMethodResolution
Representative PR domain (8018873)
Neurofibromin

Homo sapiens (9606)

 P21359 1206-1550

Derived from SCOP domain 19110
rasmol icon 1NF1 A:1206-1550 X-RAY DIFFRACTION 2.5
Representative FA domain (8018874)
Neurofibromin

Homo sapiens (9606)

 P21359 1206-1550

Derived from SCOP domain 19110
rasmol icon 1NF1 A:1206-1550 X-RAY DIFFRACTION 2.5
Representative PR domain (8018878)
Neurofibromin

Homo sapiens (9606)

 P21359 1581-1837

rasmol icon 2D4Q A:1560-1816 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 2D4Q B:1560-1816 X-RAY DIFFRACTION 2.30
rasmol icon 2E2X A:1567-1816 The ends of this domain were trimmed X-RAY DIFFRACTION 2.5
rasmol icon 2E2X B:1567-1816 The ends of this domain were trimmed X-RAY DIFFRACTION 2.5
rasmol icon 3P7Z A:1560-1816 X-RAY DIFFRACTION 2.650
rasmol icon 3P7Z B:1560-1816 X-RAY DIFFRACTION 2.650
rasmol icon 3PEG A:1564-1816 The ends of this domain were trimmed X-RAY DIFFRACTION 2.524
rasmol icon 3PG7 A:1560-1815 X-RAY DIFFRACTION 2.189
rasmol icon 3PG7 B:1560-1815 X-RAY DIFFRACTION 2.189
Representative FA domain (8018887)
Neurofibromin

Homo sapiens (9606)

 P21359 1737-1834

rasmol icon 2D4Q A:1716-1813 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 2D4Q B:1716-1813 X-RAY DIFFRACTION 2.30
rasmol icon 2E2X A:1716-1813 X-RAY DIFFRACTION 2.5
rasmol icon 2E2X B:1716-1813 X-RAY DIFFRACTION 2.5
rasmol icon 3P7Z A:1716-1813 X-RAY DIFFRACTION 2.650
rasmol icon 3P7Z B:1716-1813 X-RAY DIFFRACTION 2.650
rasmol icon 3PEG A:1716-1813 X-RAY DIFFRACTION 2.524
rasmol icon 3PG7 A:1716-1812 X-RAY DIFFRACTION 2.189
rasmol icon 3PG7 B:1716-1812 X-RAY DIFFRACTION 2.189
Representative FA domain (8018888)
Neurofibromin
closed conformation

Homo sapiens (9606)

 P21359 1581-1719

rasmol icon 2D4Q A:1560-1698 X-RAY DIFFRACTION 2.30
Clustered domains rasmol icon 2D4Q B:1560-1698 X-RAY DIFFRACTION 2.30
rasmol icon 2E2X A:1567-1698 The ends of this domain were trimmed X-RAY DIFFRACTION 2.5
rasmol icon 2E2X B:1567-1698 The ends of this domain were trimmed X-RAY DIFFRACTION 2.5
rasmol icon 3P7Z A:1560-1698 X-RAY DIFFRACTION 2.650
rasmol icon 3P7Z B:1560-1698 X-RAY DIFFRACTION 2.650
rasmol icon 3PEG A:1564-1698 The ends of this domain were trimmed X-RAY DIFFRACTION 2.524
rasmol icon 3PG7 A:1560-1698 X-RAY DIFFRACTION 2.189
rasmol icon 3PG7 B:1560-1698 X-RAY DIFFRACTION 2.189