Representative Sequence

SPROT P0AG30

Transcription termination factor Rho (23937)

1
61
121
181
241
301
361
MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQD GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVN FDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP KAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHV QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF FGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDY NRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKRS 60
120
180
240
300
360
419

Domains PDB ID RegionMethodResolution
Representative SP domain (8018225)
Transcription termination factor Rho

Escherichia coli (562)

 P0AG30 1-417

Derived from SCOP domain 115792
rasmol icon 1XPU A:1-417 X-RAY DIFFRACTION 3.05
Clustered domains

Escherichia coli BL21(DE3) (469008)

rasmol icon 1A62 A:1-125 The ends of this domain were trimmed X-RAY DIFFRACTION 1.55

Escherichia coli BL21(DE3) (469008)

rasmol icon 1A63 A:1-130 The ends of this domain were trimmed SOLUTION NMR n/a
rasmol icon 1A8V A:1-118 Some residues were not observed X-RAY DIFFRACTION 2.0
rasmol icon 1A8V B:1-118 The ends of this domain were trimmed X-RAY DIFFRACTION 2.0
rasmol icon 1PV4 A:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1PV4 B:1-417 Some residues were not observed X-RAY DIFFRACTION 3.00
rasmol icon 1PV4 C:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1PV4 D:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1PV4 E:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1PV4 F:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1PVO A:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1PVO B:51-417 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00
rasmol icon 1PVO C:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1PVO D:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1PVO E:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1PVO F:1-417 X-RAY DIFFRACTION 3.00
rasmol icon 1XPO A:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPO B:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPO C:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPO D:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPO E:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPO F:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPR A:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPR B:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPR C:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPR D:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPR E:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPR F:1-417 X-RAY DIFFRACTION 3.15
rasmol icon 1XPU B:1-417 X-RAY DIFFRACTION 3.05
rasmol icon 1XPU C:1-417 X-RAY DIFFRACTION 3.05
rasmol icon 1XPU D:1-417 X-RAY DIFFRACTION 3.05
rasmol icon 1XPU E:1-417 X-RAY DIFFRACTION 3.05
rasmol icon 1XPU F:1-417 X-RAY DIFFRACTION 3.05

Dickeya chrysanthemi Ech1591 (561229)

rasmol icon 2A8V A:1-118 The ends of this domain were trimmed X-RAY DIFFRACTION 2.4

Dickeya chrysanthemi Ech1591 (561229)

rasmol icon 2A8V B:1-118 The ends of this domain were trimmed X-RAY DIFFRACTION 2.4

Dickeya chrysanthemi Ech1591 (561229)

rasmol icon 2A8V C:1-118 The ends of this domain were trimmed X-RAY DIFFRACTION 2.4
rasmol icon 2HT1 A:31-354 The ends of this domain were trimmed X-RAY DIFFRACTION 3.51
rasmol icon 2HT1 B:31-354 The ends of this domain were trimmed X-RAY DIFFRACTION 3.51

Escherichia coli K-12 (83333)

rasmol icon 3ICE A:1-415 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE B:1-415 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE C:1-415 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE D:1-415 The ends of this domain were trimmed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE E:1-415 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE F:1-415 Some residues were not observed X-RAY DIFFRACTION 2.80
Representative SP domain (8018226)
Transcription termination factor Rho

Escherichia coli BL21(DE3) (469008)

 P0AG30 1-125

Derived from SCOP domain 64709
rasmol icon 1A62 A:1-125 X-RAY DIFFRACTION 1.55
Clustered domains rasmol icon 1A63 A:1-125 SOLUTION NMR n/a

Escherichia coli (562)

rasmol icon 1A8V A:1-118 Some residues were not observed X-RAY DIFFRACTION 2.0

Escherichia coli (562)

rasmol icon 1A8V B:1-118 The ends of this domain were trimmed X-RAY DIFFRACTION 2.0

Escherichia coli (562)

rasmol icon 1PV4 A:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PV4 B:1-125 Some residues were not observed X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PV4 C:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PV4 D:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PV4 E:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PV4 F:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PVO A:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PVO B:51-125 The ends of this domain were trimmed X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PVO C:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PVO D:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PVO E:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1PVO F:1-125 X-RAY DIFFRACTION 3.00

Escherichia coli (562)

rasmol icon 1XPO A:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPO B:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPO C:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPO D:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPO E:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPO F:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPR A:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPR B:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPR C:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPR D:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPR E:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPR F:1-125 X-RAY DIFFRACTION 3.15

Escherichia coli (562)

rasmol icon 1XPU A:1-125 X-RAY DIFFRACTION 3.05

Escherichia coli (562)

rasmol icon 1XPU B:1-125 X-RAY DIFFRACTION 3.05

Escherichia coli (562)

rasmol icon 1XPU C:1-125 X-RAY DIFFRACTION 3.05

Escherichia coli (562)

rasmol icon 1XPU D:1-125 X-RAY DIFFRACTION 3.05

Escherichia coli (562)

rasmol icon 1XPU E:1-125 X-RAY DIFFRACTION 3.05

Escherichia coli (562)

rasmol icon 1XPU F:1-125 X-RAY DIFFRACTION 3.05

Dickeya chrysanthemi Ech1591 (561229)

rasmol icon 2A8V A:1-118 The ends of this domain were trimmed X-RAY DIFFRACTION 2.4

Dickeya chrysanthemi Ech1591 (561229)

rasmol icon 2A8V B:1-118 The ends of this domain were trimmed X-RAY DIFFRACTION 2.4

Dickeya chrysanthemi Ech1591 (561229)

rasmol icon 2A8V C:1-118 The ends of this domain were trimmed X-RAY DIFFRACTION 2.4

Escherichia coli (562)

rasmol icon 2HT1 A:31-125 The ends of this domain were trimmed X-RAY DIFFRACTION 3.51

Escherichia coli (562)

rasmol icon 2HT1 B:31-125 The ends of this domain were trimmed X-RAY DIFFRACTION 3.51

Escherichia coli K-12 (83333)

rasmol icon 3ICE A:1-125 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE B:1-125 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE C:1-125 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE D:1-125 X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE E:1-125 Some residues were not observed X-RAY DIFFRACTION 2.80

Escherichia coli K-12 (83333)

rasmol icon 3ICE F:1-125 Some residues were not observed X-RAY DIFFRACTION 2.80