Representative Sequence

SPROT Q07157

Tight junction protein ZO-1 (24741)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
1441
1501
1561
1621
1681
1741
MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVL KGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPD PEPVSDNEEDSYDEEIHDPRSGRSGVVNRRSEKIWPRDRSASRERSLSPRSDRRSVASSQ PAKPTKVTLVKSRKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENM SLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHS GRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSRDEERISKPGAVSTPVKHAD DHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIR EEAVLFLLDLPKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKG EVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRAD FWRFRGLRSSKRNLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREK LAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQ WYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMND GWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSP QAQPQPIHRIDSPGFKPASQQKAEASSPVPYLSPETNPASSTSAVNHNVNLTNVRLEEPT PAPSTSYSPQADSLRTPSTEAAHIMLRDQEPSLSSHVDPTKVYRKDPYPEEMMRQNHVLK QPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESSSYTDQFSRNYEHRLRY EDRVPMYEEQWSYYDDKQPYPSRPPFDNQHSQDLDSRQHPEESSERGYFPRFEEPAPLSY DSRPRYEQAPRASALRHEEQPAPGYDTHGRLRPEAQPHPSAGPKPAESKQYFEQYSRSYE QVPPQGFTSRAGHFEPLHGAAAVPPLIPSSQHKPEALPSNTKPLPPPPTQTEEEEDPAMK PQSVLTRVKMFENKRSASLETKKDVNDTGSFKPPEVASKPSGAPIIGPKPTSQNQFSEHD KTLYRIPEPQKPQLKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIAASHL SEPAKPAHSQNQSNFSSYSSKGKPPEADGVDRSFGEKRYEPIQATPPPPPLPSQYAQPSQ PVTSASLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYP QKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHK PDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSA VEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNS ILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANC VSVLIDHF 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1260
1320
1380
1440
1500
1560
1620
1680
1740
1748

Domains PDB ID RegionMethodResolution
Representative PR domain (8019118)
Tight junction protein ZO-1

Homo sapiens (9606)

 Q07157 421-802

rasmol icon 3SHW A:421-802 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 3LH5 A:516-802 The ends of this domain were trimmed X-RAY DIFFRACTION 2.60
rasmol icon 3SHU A:6-96 The ends of this domain were trimmed X-RAY DIFFRACTION 2.75
rasmol icon 3SHU B:6-97 The ends of this domain were trimmed X-RAY DIFFRACTION 2.75
rasmol icon 3TSV A:421-512 The ends of this domain were trimmed X-RAY DIFFRACTION 1.989
rasmol icon 3TSW A:421-802 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW B:421-802 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW C:421-802 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW D:421-802 X-RAY DIFFRACTION 2.847
rasmol icon 3TSZ A:421-802 X-RAY DIFFRACTION 2.502
rasmol icon 4Q2Q A:420-503 The ends of this domain were trimmed X-RAY DIFFRACTION 1.4500
Representative FA domain (8019119)
Tight junction protein ZO-1

Homo sapiens (9606)

 Q07157 642-796

rasmol icon 3SHW A:642-796 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 3LH5 A:642-796 X-RAY DIFFRACTION 2.60
rasmol icon 3TSW A:642-796 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW B:642-796 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW C:642-796 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW D:642-796 X-RAY DIFFRACTION 2.847
rasmol icon 3TSZ A:642-796 X-RAY DIFFRACTION 2.502
Representative FA domain (8019120)
Tight junction protein ZO-1

Homo sapiens (9606)

 Q07157 516-580

rasmol icon 3SHW A:516-580 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 3LH5 A:516-580 X-RAY DIFFRACTION 2.60
rasmol icon 3TSW A:516-580 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW B:516-580 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW C:516-580 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW D:516-580 X-RAY DIFFRACTION 2.847
rasmol icon 3TSZ A:516-580 X-RAY DIFFRACTION 2.502
Representative FA domain (8019121)
Tight junction protein ZO-1

Homo sapiens (9606)

 Q07157 421-502

rasmol icon 3SHW A:421-502 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 3SHU A:6-87 X-RAY DIFFRACTION 2.75
rasmol icon 3SHU B:6-87 X-RAY DIFFRACTION 2.75
rasmol icon 3TSV A:421-502 X-RAY DIFFRACTION 1.989
rasmol icon 3TSW A:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW B:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW C:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW D:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSZ A:421-502 X-RAY DIFFRACTION 2.502
rasmol icon 4Q2Q A:420-501 X-RAY DIFFRACTION 1.4500
Representative SF domain (8019122)
Tight junction protein ZO-1

Homo sapiens (9606)

 Q07157 421-502

rasmol icon 3SHW A:421-502 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 3SHU A:6-87 X-RAY DIFFRACTION 2.75
rasmol icon 3SHU B:6-87 X-RAY DIFFRACTION 2.75
rasmol icon 3TSV A:421-502 X-RAY DIFFRACTION 1.989
rasmol icon 3TSW A:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW B:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW C:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW D:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSZ A:421-502 X-RAY DIFFRACTION 2.502
rasmol icon 4Q2Q A:420-501 X-RAY DIFFRACTION 1.4500
Representative CF domain (8019123)
Tight junction protein ZO-1

Homo sapiens (9606)

 Q07157 421-502

rasmol icon 3SHW A:421-502 X-RAY DIFFRACTION 2.90
Clustered domains rasmol icon 3SHU A:6-87 X-RAY DIFFRACTION 2.75
rasmol icon 3SHU B:6-87 X-RAY DIFFRACTION 2.75
rasmol icon 3TSV A:421-502 X-RAY DIFFRACTION 1.989
rasmol icon 3TSW A:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW B:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW C:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSW D:421-502 X-RAY DIFFRACTION 2.847
rasmol icon 3TSZ A:421-502 X-RAY DIFFRACTION 2.502
rasmol icon 4Q2Q A:420-501 X-RAY DIFFRACTION 1.4500