Representative Sequence

SPROT Q980K5

RNase L inhibitor (29112)

1
61
121
181
241
301
361
421
481
541
MRVAVINYDFCKPDKCNLECINFCPVDRSGGKAIELSEIVKGKPVIYEETCIGCGICVKK CPYEAISIVNLPDELEGEVIHRYKVNGFKLFGLPTPKNNTILGVLGKNGVGKTTVLKILA GEIIPNFGDPNSKVGKDEVLKRFRGKEIYNYFKELYSNELKIVHKIQYVEYASKFLKGTV NEILTKIDERGKKDEVKELLNMTNLWNKDANILSGGGLQRLLVAASLLREADVYIFDEPS SYLDVRERMNMAKAIRELLKNKYVIVVDHDLIVLDYLTDLIHIIYGESSVYGRVSKSYAA RVGINNFLKGYLPAENMKIRPDEIKFMLKEVSDLDLSKDLKTKMKWTKIIKKLGDFQLVV DNGEAKEGEIIGILGPNGIGKTTFARILVGEITADEGSVTPEKQILSYKPQRIFPNYDGT VQQYLENASKDALSTSSWFFEEVTKRLNLHRLLESNVNDLSGGELQKLYIAATLAKEADL YVLDEPSSYLDVEERYIVAKAIKRVTRERKAVTFIIDHDLSIHDYIADRIIVFKGEPEKA GLATSPVTLKTGMNEFLRELEVTFRRDAETGRPRVNKIGSYLDRVQKERGDYYSMVLSTQ 60
120
180
240
300
360
420
480
540
600

Domains PDB ID RegionMethodResolution
Representative PR domain (8018468)
RNase L inhibitor

Sulfolobus solfataricus (2287)

 Q980K5 76-599

rasmol icon 3OZX A:76-599 X-RAY DIFFRACTION 2.05
Clustered domains rasmol icon 3OZX B:76-599 X-RAY DIFFRACTION 2.05
Representative FA domain (8018469)
RNase L inhibitor

Sulfolobus solfataricus (2287)

 Q980K5 80-298

rasmol icon 3OZX A:80-298 X-RAY DIFFRACTION 2.05
Clustered domains rasmol icon 3OZX B:80-298 X-RAY DIFFRACTION 2.05
Representative FA domain (8018470)
RNase L inhibitor

Sulfolobus solfataricus (2287)

 Q980K5 343-547

rasmol icon 3OZX A:343-547 X-RAY DIFFRACTION 2.05
Clustered domains rasmol icon 3OZX B:343-547 X-RAY DIFFRACTION 2.05