Representative Sequence

SPROT Q9WXQ8

Ferrous iron transport protein BIron(II) transport protein B (32247)

1
61
121
181
241
301
361
421
481
541
601
661
MPVKSLTRRSEISQKIVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTY KGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEM EKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNT ILHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELS EEERIGYRLLIAKRKREYVENVVKEAFADAGSKSLSLSEAIDHVLTHKFLSFPLFFALMY LVFKFTFDIAQVFSDLLDLLFSQLGSAVVNTFGENAFTSLISDGIIGGVGSVLVFTPNIF AMFLALGFLEESGYLPRAAFVMDRIMEKFKLSGRAFMSLILGFGCNVPSIMATRAIDDPR ERLVTILITPFISCSARLPVYLLILRIFFPESSAAMLFIIYSLSILITLLSSVVINWLFY RGRTSPLILELPRYRMPTLKNLYIYTWNRGKHFLKKAGTIIFVSAILIWVLSYFPAAGDI ENSFSAMIGKSLEWIFKPFGYSWKIVTSLFYGAVAKEVVVSTMSMLYGFEEETFLGAKEA LSAEMDPVSAIAFLIFVMAYIPCFATIATIYSETGSLKWTLFSIGYSLSIAYVLSLIVFY VGKLVVMLI 60
120
180
240
300
360
420
480
540
600
660
669

Domains PDB ID RegionMethodResolution
Representative SP domain (8019396)
Ferrous iron transport protein BIron(II) transport protein B

Thermotoga maritima (2336)

 Q9WXQ8 17-268

rasmol icon 3A1S A:17-268 X-RAY DIFFRACTION 1.5
Clustered domains rasmol icon 3A1S B:17-268 X-RAY DIFFRACTION 1.5
rasmol icon 3A1T A:17-268 X-RAY DIFFRACTION 1.800
rasmol icon 3A1U A:17-268 X-RAY DIFFRACTION 1.80
rasmol icon 3A1U B:17-268 X-RAY DIFFRACTION 1.80
rasmol icon 3A1V A:17-268 X-RAY DIFFRACTION 2.400
rasmol icon 3A1V B:17-266 Some residues were not observed X-RAY DIFFRACTION 2.400
rasmol icon 3A1W A:17-177 Some residues were not observed X-RAY DIFFRACTION 1.9001
Representative PR domain (8019397)
Ferrous iron transport protein BIron(II) transport protein B

Thermotoga maritima (2336)

 Q9WXQ8 17-268

rasmol icon 3A1S A:17-268 X-RAY DIFFRACTION 1.5
Clustered domains rasmol icon 3A1S B:17-268 X-RAY DIFFRACTION 1.5
rasmol icon 3A1T A:17-268 X-RAY DIFFRACTION 1.800
rasmol icon 3A1U A:17-268 X-RAY DIFFRACTION 1.80
rasmol icon 3A1U B:17-268 X-RAY DIFFRACTION 1.80
rasmol icon 3A1V A:17-268 X-RAY DIFFRACTION 2.400
rasmol icon 3A1V B:17-266 Some residues were not observed X-RAY DIFFRACTION 2.400
rasmol icon 3A1W A:17-177 Some residues were not observed X-RAY DIFFRACTION 1.9001
Representative FA domain (8019398)
Ferrous iron transport protein BIron(II) transport protein B

Thermotoga maritima (2336)

 Q9WXQ8 17-179

rasmol icon 3A1S A:17-179 X-RAY DIFFRACTION 1.5
Clustered domains rasmol icon 3A1S B:17-179 X-RAY DIFFRACTION 1.5
rasmol icon 3A1T A:17-179 X-RAY DIFFRACTION 1.800
rasmol icon 3A1U A:17-179 X-RAY DIFFRACTION 1.80
rasmol icon 3A1U B:17-179 X-RAY DIFFRACTION 1.80
rasmol icon 3A1V A:17-179 X-RAY DIFFRACTION 2.400
rasmol icon 3A1V B:17-179 Some residues were not observed X-RAY DIFFRACTION 2.400
rasmol icon 3A1W A:17-177 Some residues were not observed X-RAY DIFFRACTION 1.9001