Representative Sequence

SPROT Q5M586

Ferrous iron uptake transporter protein B (32927)

1
61
121
181
241
301
361
421
481
541
601
661
MTEIALIGNPNSGKTSLFNLITGHNQRVGNWPGVTVERKSGLVKKNKDLEIQDLPGIYSM SPYSPEEKVARDYLLSQRADSILNVVDATNLERNLYLTTQLIETGIPVTIALNMIDVLDG QGKKINVDKLSYHLGVPVVATSALKQTGVDQVVKKAAHTTTSTVGDLAFPIYDDRLEAAI SQILEVLGNSVPQRSARFYAIKLFEQDSLVEAELDLSQFQRKEIEDIIRITEEIFTEDAE SIVINERYAFIERVCQMAESHTEDFALTLSDKIDRIVTNRILALPIFSVVMYLVYFLSIQ TVGTMWTDWANDVLFGKYVPDLVSSGLDYLQVQDWLKSLIVDGIVAGIGTVLGFLPQIFV LFICLGVLEDIGYMSRIAFVMDRIFRRFGLSGKSFIPMLISTGCGVPAVMSSRTIENERD RRITIMTATFMPCSAKLEIIALIAGAFFPGNSFVAPSTYFIGIATIILSGIALKKTSFLG GLTSPFIMELPAYHWPKVLSVLRYAFGKAMSFVKRAGTIIFSLTVLIWFMSNYNFMLQNV DTEVSILATLGKGLSWIFEPLGFGNWQATVAALAGLAAKETVVATFGILYHNSSEAGLAT ALQADYSALAAYSFLIFNLLCAPCFAAIGAIKREMANLRWTVGAIGFQTGLAYCVSLILY QFGQVLLYGNPISLWTLVAVLFLVTMIYFVVRKPRQIKDKIITLENLQEANS 60
120
180
240
300
360
420
480
540
600
660
712

Domains PDB ID RegionMethodResolution
Representative PR domain (8019393)
Ferrous iron uptake transporter protein B

Streptococcus thermophilus LMG 18311 (264199)

 Q5M586 1-264

rasmol icon 3B1V A:1-264 X-RAY DIFFRACTION 1.8500
Clustered domains rasmol icon 3B1W A:1-261 The ends of this domain were trimmed X-RAY DIFFRACTION 2.50
rasmol icon 3B1W B:1-259 The ends of this domain were trimmed X-RAY DIFFRACTION 2.50
rasmol icon 3B1W C:1-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.50
rasmol icon 3B1W D:1-257 The ends of this domain were trimmed X-RAY DIFFRACTION 2.50
rasmol icon 3B1X A:1-259 The ends of this domain were trimmed X-RAY DIFFRACTION 2.6100
rasmol icon 3B1X B:1-257 The ends of this domain were trimmed X-RAY DIFFRACTION 2.6100
rasmol icon 3B1Y A:1-259 Some residues were not observed X-RAY DIFFRACTION 2.5000
rasmol icon 3B1Z A:1-257 The ends of this domain were trimmed X-RAY DIFFRACTION 2.6500
rasmol icon 3LX5 A:2-264 The ends of this domain were trimmed X-RAY DIFFRACTION 1.900
rasmol icon 3LX8 A:1-258 The ends of this domain were trimmed X-RAY DIFFRACTION 2.900
rasmol icon 3SS8 A:1-257 The ends of this domain were trimmed X-RAY DIFFRACTION 2.5100
rasmol icon 3SS8 B:1-257 The ends of this domain were trimmed X-RAY DIFFRACTION 2.5100
rasmol icon 3TAH A:1-259 The ends of this domain were trimmed X-RAY DIFFRACTION 1.85
rasmol icon 3TAH B:1-262 The ends of this domain were trimmed X-RAY DIFFRACTION 1.85
rasmol icon 4NON A:1-260 The ends of this domain were trimmed X-RAY DIFFRACTION 2.5000
rasmol icon 4NON B:1-260 Some residues were not observed X-RAY DIFFRACTION 2.5000