Representative Sequence

SPROT Q8U306

RNase l inhibitor (34461)

1
61
121
181
241
301
361
421
481
541
MRIAVIDYDKCNPDKCGHFLCERVCPVNRMGGEAIIIDEENYKPIIQEASCTGCGICVHK CPFKAISIVNLPEQLEEDCVHRYGVNAFVLYRLPVVKEGMVVGIVGPNGTGKSTAVKILA GQLIPNLCGDNDSWDGVIRAFRGNELQNYFEKLKNGEIRPVVKPQYVDLIPKAVKGKVIE LLKKADETGKLEEVVKALELENVLDREIQHLSGGELQRVAIAAALLRNATFYFFDEPSSY LDIRQRLNAARAIRRLSEEGKSVLVVEHDLAVLDYLSDIIHVVYGEPGVYGIFSQPKGTR NGINEFLRGYLKDENVRFRPYEIKFTKTGERVEIERETLVTYPRLVKDYGSFRLEVEPGE IKKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKIEWDLTVAYKPQYIKADYEGTVYELL SKIDASKLNSNFYKTELLKPLGIIDLYDREVNELSGGELQRVAIAATLLRDADIYLLDEP SAYLDVEQRLAVSRAIRHLMEKNEKTALVVEHDVLMIDYVSDRLMVFEGEPGKYGRALPP MGMREGMNRFLASIGITFRRDPDTGRPRANKEGSVKDREQKEKGEYYYIA 60
120
180
240
300
360
420
480
540
590

Domains PDB ID RegionMethodResolution
Representative PR domain (8018463)
RNase l inhibitor

Pyrococcus furiosus (2261)

 Q8U306 76-590

rasmol icon 1YQT A:76-590 X-RAY DIFFRACTION 1.9
Representative FA domain (8018464)
RNase l inhibitor

Pyrococcus furiosus (2261)

 Q8U306 80-298

rasmol icon 1YQT A:80-298 X-RAY DIFFRACTION 1.9
Representative FA domain (8018465)
RNase l inhibitor

Pyrococcus furiosus (2261)

 Q8U306 339-542

rasmol icon 1YQT A:339-542 X-RAY DIFFRACTION 1.9