Representative Sequence

SPROT Q580I4

Putative uncharacterized protein CACNB4 (34703)

1
61
121
181
241
ISITRVTADISLAKRSVLNNPSKRAIIERSNTRSSLAEVQSEIERIFELARSLQLVVLDA DTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPE MFDVILDENQLEDACEHLGEYLEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGL QSQRMRHSNHSTENSPIERRSLMTSDENYHNERARKSRNRLSSSSQHSRDHYPLVEEDYP DSYQDTYKPHRNRGSPGGYSHDSRHRL 60
120
180
240
267

Domains PDB ID RegionMethodResolution
Representative FA domain (8019103)
Putative uncharacterized protein CACNB4

Rattus norvegicus (10116)

 Q580I4 186-369

Derived from SCOP domain 108916
rasmol icon 1VYV A:219-402 X-RAY DIFFRACTION 3
Representative PR domain (8019104)
Putative uncharacterized protein CACNB4

Rattus norvegicus (10116)

 Q580I4 38-370

Derived from SCOP domain 108919
rasmol icon 1VYV A:71-403 X-RAY DIFFRACTION 3
Representative FA domain (8019105)
Putative uncharacterized protein CACNB4

Rattus norvegicus (10116)

 Q580I4 58-123

Derived from SCOP domain 108919
rasmol icon 1VYV A:91-156 X-RAY DIFFRACTION 3