Representative Sequence

SPROT Q8U2H8

Ferrous iron transport protein b (34750)

1
61
121
181
241
301
361
421
481
541
601
661
MLKTVALVGNPNVGKTTIFNALTGLRQHVGNWPGVTVEKKEGIMEYREKEFLVVDLPGIY SLTAHSIDELIARNFILDGNADVIVDIVDSTCLMRNLFLTLELFEMEVKNIILVLNKFDL LKKKGAKIDIKKMRKELGVPVIPTNAKKGEGVEELKRMIALMAEGKVTTNPIIPRYDEDI EREIKHISELLRGTPLAEKYPIRWLALKLLQRDEEVIKLVLKYLGQEKMDEILKHISELE EKYKRPLDIVIASQKYEFLEQLLRKFVVHEPEVKENLANQLDRLLTHPVYGMISLLITFY LVFKFVFTFGFPLQELLDTAFSQLGESIAPYIGNEALRGLIVDGIIGGVGTVVSFFPLVF LLFVAMSILEDVGYLARIAAMMERFMRIFRLPGKAVIPMVLAFGCNVPAIMATRTIENEK ERIITLLINPLVPCVARMTVITFLAGTFFPDRAPLVAIAIYAIAIGLALLSSLLLGKFIV KGEESPFIIELPEYLIPSWRVVLVHSWERSKEFLKKAATVILFGSILIWYLSSYPEPVGN GISYAERLGKIFEPLMKLMGLDWKAAVALLFGIIAKENTIVAYSIIYGVSEESLAGTLAG IMTPLQAFVLALVTTLYMPCIATLAAIRAEGGTKWMIMAALYNLLLATVIGIAVYQIGGI IYG 60
120
180
240
300
360
420
480
540
600
660
663

Domains PDB ID RegionMethodResolution
Representative PR domain (8019394)
Ferrous iron transport protein b

Pyrococcus furiosus (2261)

 Q8U2H8 2-269

rasmol icon 3K53 A:3-270 X-RAY DIFFRACTION 2.70
Clustered domains rasmol icon 3K53 B:3-269 The ends of this domain were trimmed X-RAY DIFFRACTION 2.70
rasmol icon 3K53 C:3-270 Some residues were not observed X-RAY DIFFRACTION 2.70
rasmol icon 3K53 D:3-270 X-RAY DIFFRACTION 2.70
Representative FA domain (8019395)
Ferrous iron transport protein b

Methanocaldococcus jannaschii (2190)

 Q8U2H8 1-153

rasmol icon 2WJG A:1-153 X-RAY DIFFRACTION 2.200
Clustered domains

Pyrococcus furiosus (2261)

rasmol icon 3K53 A:3-154 The ends of this domain were trimmed X-RAY DIFFRACTION 2.70

Pyrococcus furiosus (2261)

rasmol icon 3K53 B:3-154 The ends of this domain were trimmed X-RAY DIFFRACTION 2.70

Pyrococcus furiosus (2261)

rasmol icon 3K53 C:3-154 Some residues were not observed X-RAY DIFFRACTION 2.70

Pyrococcus furiosus (2261)

rasmol icon 3K53 D:3-154 The ends of this domain were trimmed X-RAY DIFFRACTION 2.70