Representative Sequence

SPROT Q8XIQ9

Probable manganase-dependent inorganic pyrophosphatase (34831)

1
61
121
181
241
301
361
421
481
541
MKDVIYITGHKNPDSDSICAALAYAEFKNKTQDTPAIPVRLGNVSQETQYILDYFGVEAP QFLETVKLKVEDLEMDKIAPLAPEVSLKMAWNIMRDKNLKSIPVADGNNHLLGMLSTSNI TATYMDIWDSNILAKSATSLDNILDTLSAEAQNINEERKVFPGKVVVAAMQAESLKEFIS EGDIAIAGDRAEIQAELIELKVSLLIVTGGHTPSKEIIELAKKNNITVITTPHDSFTASR LIVQSLPVDYVMTKDNLVAVSTDDLVEDVKVTMSETRYSNYPVIDENNKVVGSIARFHLI STHKKKVIQVDHNERGQSVHGLEDAEVLEIIDHHRVADIQTGNPIYFRNEPLGSTSTIVA KRFFENGIRPSREAAGLLCGAIISDTLLFKSPTCTPQDVKMCRKLAEIAGIVPETFAKEM FKAGTSLKGKSIEEIFNADFKPFTIEGVKVGVAQVNTMDIEGFMPLKGEMLDYMNQKAES MGLEMIMLLLTDIINEGSQILVAGRSPEIAEEAFKVKLEDSTTFLPGVLSRKKQVVPPLT QIITTRVSK 60
120
180
240
300
360
420
480
540
549

Domains PDB ID RegionMethodResolution
Representative PR domain (8018068)
Probable manganase-dependent inorganic pyrophosphatase

Clostridium perfringens str. 13 (195102)

 Q8XIQ9 66-297

rasmol icon 3L2B A:66-297 X-RAY DIFFRACTION 2.270
Clustered domains rasmol icon 3L2B B:67-296 The ends of this domain were trimmed X-RAY DIFFRACTION 2.270
rasmol icon 3L31 A:66-297 X-RAY DIFFRACTION 2.300
rasmol icon 3L31 B:68-297 The ends of this domain were trimmed X-RAY DIFFRACTION 2.300
Representative FA domain (8018069)
Probable manganase-dependent inorganic pyrophosphatase

Clostridium perfringens str. 13 (195102)

 Q8XIQ9 138-246

rasmol icon 3L2B A:138-246 X-RAY DIFFRACTION 2.270
Clustered domains rasmol icon 3L2B B:138-246 X-RAY DIFFRACTION 2.270
rasmol icon 3L31 A:138-246 X-RAY DIFFRACTION 2.300
rasmol icon 3L31 B:138-246 X-RAY DIFFRACTION 2.300
Representative FA domain (8018070)
Probable manganase-dependent inorganic pyrophosphatase

Clostridium perfringens str. 13 (195102)

 Q8XIQ9 66-137,247-297

rasmol icon 3L2B A:66-137,247-297 X-RAY DIFFRACTION 2.270
Clustered domains rasmol icon 3L2B B:67-137,247-296 The ends of this domain were trimmed X-RAY DIFFRACTION 2.270
rasmol icon 3L31 A:66-137,247-297 X-RAY DIFFRACTION 2.300
rasmol icon 3L31 B:68-137,247-297 The ends of this domain were trimmed X-RAY DIFFRACTION 2.300