Representative Sequence

SPROT Q8RDB0

Hydrogenase maturation factor (38245)

1
61
121
181
241
301
361
421
481
541
601
661
721
MVRGRVPQIQARQINIFGIVQGVGFRPFVFNIAQKYNLKGIVYNNSSGLYIEVEGEEKDI EAFIREIKENPPSLSVIDEIQVREVEVKEYKDFKIVGSKEDGGFVPVSPDMGVCEDCLRE LKDPKDRRYRYPFINCTNCGPRFSIIEDIPYDRAKTSMKVFPMCEKCSREYHDPHDRRFH AQPVACFDCGPSLSFVGEGCFDDEIKCVAKALKEGKIVAIKGIGGFHLAVNALDDEAVAT LRRRKKRYGKPFAVMMRDVEEVKKYCIVSPEEERLLLSQRRPIVLLKKKGEKLAKGIADD LDTLGVMLPYAPIHYLLMEEIDFPIVMTSGNVSEEPICKDNEEALEKLKDIADVFLLNNR DIVNRIDDSVTSFNAGAERIIRRARGYAPQPILLKKEVKASILAVGGFYKNTFCMTKGHY AFISHHIGDLDNEKAFNYYIEQIERYKKLFRVDPEVVAHDMHKGYLSTQYAKSLDLPKIE VQHHHAHIASCMAEHNLDEKVIGIAYDGTGYGTDGNVWGAEILVCDLKSFERIAHLKYKP LPGNELAIKKIYRTALGFIFDNISFYKNFVEQVDSRELDIILKQIDRKINTAYVSSMGRF FDAVAALIGVRKEVLFEGQAAMELESLMAESEEYYEYEILKEDRYVIDPELILRQIYEDY MKGFEKSYISAKFHNTVVNFTYDLANLIRKETGINKVVLSGGSFQNRYLLRRLIEKLSLS GFEVYSNSKVPCNDGGISLGQAVIANKILEG 60
120
180
240
300
360
420
480
540
600
660
720
751

Domains PDB ID RegionMethodResolution
Representative SP domain (8004419)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 3-751

rasmol icon 3VTH A:3-751 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:103-751 Some residues were not observed X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:8-751 The ends of this domain were trimmed X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:8-751 The ends of this domain were trimmed X-RAY DIFFRACTION 2.56
Representative PR domain (8004420)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 3-751

rasmol icon 3VTH A:3-751 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:103-751 Some residues were not observed X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:8-751 The ends of this domain were trimmed X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:8-751 The ends of this domain were trimmed X-RAY DIFFRACTION 2.56
Representative FA domain (8004421)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 9-105

rasmol icon 3VTH A:9-105 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTI A:9-105 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:9-105 X-RAY DIFFRACTION 2.56
Representative SF domain (8004422)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 9-105

rasmol icon 3VTH A:9-105 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTI A:9-105 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:9-105 X-RAY DIFFRACTION 2.56
Representative CF domain (8004423)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 9-86

rasmol icon 3VTH A:9-86 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTI A:9-86 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:9-86 X-RAY DIFFRACTION 2.56
Representative FA domain (8004424)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 397-751

rasmol icon 3VTH A:397-751 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:397-751 X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:397-751 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:397-751 X-RAY DIFFRACTION 2.56
Representative SF domain (8004425)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 397-751

rasmol icon 3VTH A:397-751 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:397-751 X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:397-751 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:397-751 X-RAY DIFFRACTION 2.56
Representative CF domain (8004426)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 397-482

rasmol icon 3VTH A:397-482 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:397-482 X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:397-482 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:397-482 X-RAY DIFFRACTION 2.56
Representative CF domain (8004427)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 498-727

rasmol icon 3VTH A:498-727 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:498-727 X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:498-727 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:498-727 X-RAY DIFFRACTION 2.56
Representative IR domain (8004428)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 397-497

rasmol icon 3VTH A:397-497 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:397-497 X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:397-497 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:397-497 X-RAY DIFFRACTION 2.56
Representative IR domain (8004429)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 498-751

rasmol icon 3VTH A:498-751 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:498-751 X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:498-751 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:498-751 X-RAY DIFFRACTION 2.56
Representative FA domain (8004430)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 202-385

rasmol icon 3VTH A:202-385 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:204-385 The ends of this domain were trimmed X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:202-385 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:202-385 X-RAY DIFFRACTION 2.56
Representative SF domain (8004431)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 202-385

rasmol icon 3VTH A:202-385 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:204-385 The ends of this domain were trimmed X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:202-385 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:202-385 X-RAY DIFFRACTION 2.56
Representative CF domain (8004432)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 202-359

rasmol icon 3VTH A:202-359 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:204-359 The ends of this domain were trimmed X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:202-359 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:202-359 X-RAY DIFFRACTION 2.56
Representative FA domain (8004433)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 110-143

rasmol icon 3VTH A:110-143 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:110-143 X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:110-143 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:110-143 X-RAY DIFFRACTION 2.56
Representative FA domain (8004434)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 160-193

rasmol icon 3VTH A:160-193 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:160-185 The ends of this domain were trimmed X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:160-193 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:160-193 X-RAY DIFFRACTION 2.56
Representative CF domain (8004435)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 110-143

rasmol icon 3VTH A:110-143 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:110-143 X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:110-143 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:110-143 X-RAY DIFFRACTION 2.56
Representative CF domain (8004436)
Hydrogenase maturation factor

Caldanaerobacter subterraneus subsp. tengcongensis MB4 (273068)

 Q8RDB0 160-193

rasmol icon 3VTH A:160-193 X-RAY DIFFRACTION 2.00
Clustered domains rasmol icon 3VTH B:160-185 The ends of this domain were trimmed X-RAY DIFFRACTION 2.00
rasmol icon 3VTI A:160-193 X-RAY DIFFRACTION 2.56
rasmol icon 3VTI B:160-193 X-RAY DIFFRACTION 2.56