Representative Sequence

SPROT P31007

Disks large 1 tumor suppressor protein (38397)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALLDIQEFYELTL LDDSKSIQQKTAETLQIATKWEKDGQAVKIADFIKSSNLNRNCAYEFNNDASSNQTNQSA LNQNPIANNVSAQAQAEALSRTFKSELEEILNQRMRIESDTENAKEPTVEQQQKQQQAQQ RSSRSPQQQNPQQQQGSKSRSGSQTVNGDDSWLYEDIQLERGNSGLGFSIAGGTDNPHIG TDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVK RKRGTATTPAAGSAAGDARDSAASGPKVIEIDLVKGGKGLGFSIAGGIGNQHIPGDNGIY VTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGKT QHLTTSASGGGGGGLSSGQQLSQSQSQLATSQSQSQVHQQQHATPMVNSQSTEPGSRYAS TNVLAAVPPGTPRAVSTEDITREPRTITIQKGPQGLGFNIVGGEDGQGIYVSFILAGGPA DLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLLAQYRPEEYNRFEARIQEL KQQAALGAGGSGTLLRTTQKRSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDD EWWQARRVLGDNEDEQIGIVPSKRRWERKMRARDRSVKFQGHAAANNNLDKQSTLDRKKK NFTFSRKFPFMKSRDEKNEDGSDQEPFMLCYTQDDANAEGASEENVLSYEAVQRLSINYT RPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQ NHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKS VDSVMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGP TIWVPSKESL 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
970

Domains PDB ID RegionMethodResolution
Representative PR domain (8019110)
Disks large 1 tumor suppressor protein

Drosophila melanogaster (7227)

 P31007 622-966

rasmol icon 3TVT A:602-971 X-RAY DIFFRACTION 1.60
Representative FA domain (8019111)
Disks large 1 tumor suppressor protein

Drosophila melanogaster (7227)

 P31007 777-959

rasmol icon 3TVT A:783-964 X-RAY DIFFRACTION 1.60
Representative FA domain (8019112)
Disks large 1 tumor suppressor protein

Drosophila melanogaster (7227)

 P31007 622-686

rasmol icon 3TVT A:602-666 X-RAY DIFFRACTION 1.60