Representative Sequence

SPROT A8INQ0

ADP-ribosylation factor-like protein 13B (41171)

1
61
121
181
241
301
361
421
481
MFGLLVNFYRFCRKKTERKITIALLGLDNAGKTTLLNSIQGEVDRDTTPTFGFNSTTLNE GKYKIEVFDLGGGKNIRGVWKKYLAEVHAIVYVVDAADPGRFEESKMTMAEVLENQFMRD KPICIFANKQDLPTAAPAAEVVKGLGLATCRNSHNVFPCTAKMPAGQDVDHRLRDGLKWL VGTVDREFGRLDPRVQTEAEEVRQEEARKKKEREERLRKQREERLRQQKEEEERAREVEK ENELHDGKAPSLLAAGGGVVGAAAAGVNGVMVDEQQELRPPGQHQEAPEALGLHNGLALG LPHTIESPGKFPPPPRRPLEAHPASDLRLVAPDQGVSSASGGPGLGAMPSGSHGGGGVPP QPASLPHVRAALPPLPPSAPQPSDAGVGSSGSASRHPGAHSSSAAAPPNVASGAAAEDGP EPDAAGTAAGEAGSGSVFAPRPASAGGGGPGSRGSGSGMTPDARELGSGGVESGEGTPAR LRAGAQQASDGGHGNSKGSFSLVHTSNKVVPVAPDLRAGIPGAPNDA 60
120
180
240
300
360
420
480
527

Domains PDB ID RegionMethodResolution
Representative PR domain (8019561)
ADP-ribosylation factor-like protein 13B

Chlamydomonas reinhardtii (3055)

 A8INQ0 18-211

rasmol icon 4M9Q A:18-211 X-RAY DIFFRACTION 2.50
Clustered domains rasmol icon 4M9Q B:18-211 X-RAY DIFFRACTION 2.50
rasmol icon 4M9Q C:18-208 The ends of this domain were trimmed X-RAY DIFFRACTION 2.50
rasmol icon 5DI3 B:18-211 X-RAY DIFFRACTION 2.5000
Representative FA domain (8019562)
ADP-ribosylation factor-like protein 13B

Chlamydomonas reinhardtii (3055)

 A8INQ0 18-188

rasmol icon 4M9Q A:18-188 X-RAY DIFFRACTION 2.50
Clustered domains rasmol icon 4M9Q B:18-188 X-RAY DIFFRACTION 2.50
rasmol icon 4M9Q C:18-188 X-RAY DIFFRACTION 2.50
rasmol icon 5DI3 B:18-188 X-RAY DIFFRACTION 2.5000