Representative Sequence

SPROT O95267

RAS guanyl-releasing protein 1 (41213)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGA SLDDLIDSCIQSFDADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPG LCLKICYFVRYWITEFWVMFKMDASLTDTMEEFQELVKAKGEELHCRLIDTTQINARDWS RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGG LCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDFKIPILGVHLK DLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLY YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK NYDHDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVA PTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKI SLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVR KRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQ LEKSNHVLAQMEQGDCS 60
120
180
240
300
360
420
480
540
600
660
720
780
797

Domains PDB ID RegionMethodResolution
Representative PR domain (8018930)
RAS guanyl-releasing protein 1
complexed with zn, gol, cit

Homo sapiens (9606)

 O95267 53-593

rasmol icon 4L9M A:53-593 X-RAY DIFFRACTION 3.000
Representative PR domain (8018931)
RAS guanyl-releasing protein 1

Homo sapiens (9606)

 O95267 745-793

rasmol icon 4L9U A:745-793 X-RAY DIFFRACTION 1.6014
Clustered domains rasmol icon 4L9U B:745-786 The ends of this domain were trimmed X-RAY DIFFRACTION 1.6014
Representative FA domain (8018933)
RAS guanyl-releasing protein 1
complexed with zn, gol, cit

Homo sapiens (9606)

 O95267 540-593

rasmol icon 4L9M A:540-593 X-RAY DIFFRACTION 3.000
Representative FA domain (8018934)
RAS guanyl-releasing protein 1
complexed with zn, gol, cit

Homo sapiens (9606)

 O95267 461-535

rasmol icon 4L9M A:461-535 X-RAY DIFFRACTION 3.000
Representative FA domain (8018935)
RAS guanyl-releasing protein 1
complexed with zn, gol, cit

Homo sapiens (9606)

 O95267 204-436

rasmol icon 4L9M A:204-436 X-RAY DIFFRACTION 3.000
Representative FA domain (8018966)
RAS guanyl-releasing protein 1
complexed with zn, gol, cit

Homo sapiens (9606)

 O95267 60-180

rasmol icon 4L9M A:60-180 X-RAY DIFFRACTION 3.000