Representative Sequence

SPROT D9SIP4

Ferrous iron transport protein B (41336)

1
61
121
181
241
301
361
421
481
541
MKRIALLGMPNTGKSTLFNRMTGGAARVGNWPGITVELLSGKILLGADMVEIIDLPGIYD LHGFSDDEQVVRHFLHDNVPDLALVILNATQIERQMSLLLQLKQLNMNIVVLLNMSDEAK QYGITIDSRKMSELLQIPVFQLSGKYGTGYQEALQAVTRALRYPTPGMAENVRTQLEQDE HIEAEMVRILKSAVQIPARLPENLTEKLDRVMLHPVLGLPIFFGIMYLLFQGIFFFGQPL QIGIGQLLTWLRETALVPAVASLPPALQGLLLDGIYNGIATVAAFVPVIVLFFLLMAIVE DSGYLSRAAFLMDALMAKMGLDGRGFVMLLMGFGCNVPALMGTRVMRSRAMRLLTMLIIP FSLCSARLQVFVFITAALFSTHAAPLVLFSLYLFSFAAAILTALLFKQQFSNSEPFVLEL PPYRFPTLRQMVLRGYLEVTHFLRRASTFIIAGVVLVWLLTHIPFSAQPASPETVSGMIG SVLQPFFAPIGINEQLTIALLFGFVAKEIVIGSLAVIYGLTGQGLSGALAAQLDWVQAYS FMLFTLIYTPCLSTIATLKSESKSRRFTLLALVWSLALAWLVSFIFYQGARALGY 60
120
180
240
300
360
420
480
540
595

Domains PDB ID RegionMethodResolution
Representative SP domain (8019399)
Ferrous iron transport protein B

Gallionella capsiferriformans ES-2 (395494)

 D9SIP4 2-197

rasmol icon 3W5J A:2-197 X-RAY DIFFRACTION 1.932
Clustered domains rasmol icon 3W5I A:2-197 X-RAY DIFFRACTION 2.1500
rasmol icon 3W5I B:2-197 X-RAY DIFFRACTION 2.1500
rasmol icon 3W5J B:2-197 X-RAY DIFFRACTION 1.932
Representative PR domain (8019400)
Ferrous iron transport protein B

Gallionella capsiferriformans ES-2 (395494)

 D9SIP4 2-197

rasmol icon 3W5J A:2-197 X-RAY DIFFRACTION 1.932
Clustered domains rasmol icon 3W5I A:2-197 X-RAY DIFFRACTION 2.1500
rasmol icon 3W5I B:2-197 X-RAY DIFFRACTION 2.1500
rasmol icon 3W5J B:2-197 X-RAY DIFFRACTION 1.932
Representative FA domain (8019401)
Ferrous iron transport protein B

Gallionella capsiferriformans ES-2 (395494)

 D9SIP4 2-164

rasmol icon 3W5J A:2-164 X-RAY DIFFRACTION 1.932
Clustered domains rasmol icon 3W5I A:2-164 X-RAY DIFFRACTION 2.1500
rasmol icon 3W5I B:2-164 X-RAY DIFFRACTION 2.1500
rasmol icon 3W5J B:2-164 X-RAY DIFFRACTION 1.932