Representative Sequence

SPROT P51659

Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35). (5730)

1
61
121
181
241
301
361
421
481
541
601
661
721
MGSPLRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLAADKVVE EIRRRGGKAVANYDSVEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIH RVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAI EGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVG AGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLS KIDSEGGVSANHTSRATSTATSGFAGAIGQKLPPFSYAYTELEAIMYALGVGASIKDPKD LKFIYEGSSDFSCLPTFGVIIGQKSMMGGGLAEIPGLSINFAKVLHGEQYLELYKPLPRA GKLKCEAVVADVLDKGSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKV AVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFS ARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISN AYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNI GAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNI MLSQKLQMILKDYAKL 60
120
180
240
300
360
420
480
540
600
660
720
736

Domains PDB ID RegionMethodResolution
Representative PR domain (8000757)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).
complexed with nad; swapped dimer with the extra C-terminal subdomains

Homo sapiens (9606)

 P51659 3-304

Derived from SCOP domain 124862
rasmol icon 1ZBQ A:3-304 X-RAY DIFFRACTION 2.19
Clustered domains rasmol icon 1ZBQ B:3-304 X-RAY DIFFRACTION 2.19
rasmol icon 1ZBQ C:3-304 X-RAY DIFFRACTION 2.19
rasmol icon 1ZBQ D:3-304 X-RAY DIFFRACTION 2.19
rasmol icon 1ZBQ E:3-304 X-RAY DIFFRACTION 2.19
rasmol icon 1ZBQ F:3-304 X-RAY DIFFRACTION 2.19
Representative PR domain (8003944)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).
complexed with oxn, so4

Homo sapiens (9606)

 P51659 622-736

Derived from SCOP domain 66188
rasmol icon 1IKT A:6-120 X-RAY DIFFRACTION 1.75
Representative FA domain (8003945)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).
complexed with oxn, so4

Homo sapiens (9606)

 P51659 622-736

Derived from SCOP domain 66188
rasmol icon 1IKT A:6-120 X-RAY DIFFRACTION 1.75
Representative SF domain (8003946)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).
complexed with oxn, so4

Homo sapiens (9606)

 P51659 622-736

Derived from SCOP domain 66188
rasmol icon 1IKT A:6-120 X-RAY DIFFRACTION 1.75
Representative CF domain (8003947)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).
complexed with oxn, so4

Homo sapiens (9606)

 P51659 622-736

Derived from SCOP domain 66188
rasmol icon 1IKT A:6-120 X-RAY DIFFRACTION 1.75
Representative PR domain (8003948)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).

Homo sapiens (9606)

 P51659 323-606

Derived from SCOP domain 118901
rasmol icon 1S9C G:6-289 X-RAY DIFFRACTION 3.0
Clustered domains rasmol icon 1S9C A:10-289 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C B:12-289 Some residues were not observed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C C:6-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C D:9-289 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C E:12-289 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C F:8-289 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C H:12-289 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C I:7-289 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C J:12-289 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C K:11-289 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C L:12-289 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
Representative FA domain (8003949)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).

Homo sapiens (9606)

 P51659 481-606

Derived from SCOP domain 118901
rasmol icon 1S9C G:164-289 X-RAY DIFFRACTION 3.0
Clustered domains rasmol icon 1S9C A:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C B:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C C:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C D:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C E:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C F:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C H:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C I:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C J:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C K:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C L:164-289 X-RAY DIFFRACTION 3.0
Representative SF domain (8003950)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).

Homo sapiens (9606)

 P51659 481-606

Derived from SCOP domain 118901
rasmol icon 1S9C G:164-289 X-RAY DIFFRACTION 3.0
Clustered domains rasmol icon 1S9C A:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C B:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C C:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C D:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C E:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C F:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C H:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C I:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C J:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C K:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C L:164-289 X-RAY DIFFRACTION 3.0
Representative CF domain (8003951)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).

Homo sapiens (9606)

 P51659 481-606

Derived from SCOP domain 118901
rasmol icon 1S9C G:164-289 X-RAY DIFFRACTION 3.0
Clustered domains rasmol icon 1S9C A:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C B:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C C:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C D:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C E:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C F:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C H:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C I:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C J:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C K:164-289 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C L:164-289 X-RAY DIFFRACTION 3.0
Representative FA domain (8003952)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).

Homo sapiens (9606)

 P51659 323-480

Derived from SCOP domain 118902
rasmol icon 1S9C G:6-163 X-RAY DIFFRACTION 3.0
Clustered domains rasmol icon 1S9C A:10-163 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C B:12-163 Some residues were not observed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C C:6-163 X-RAY DIFFRACTION 3.0
rasmol icon 1S9C D:9-163 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C E:12-163 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C F:8-163 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C H:12-163 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C I:7-163 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C J:12-163 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C K:11-163 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
rasmol icon 1S9C L:12-163 The ends of this domain were trimmed X-RAY DIFFRACTION 3.0
Representative FA domain (8017572)
Peroxisomal multifunctional enzyme type 2 (MFE-2) (D-bifunctional protein) (DBP) (17-beta-hydroxysteroid dehydrogenase 4) (17-beta-HSD 4) (D-3-hydroxyacyl-CoA dehydratase) (EC 42.1.107) (3-alpha,7- alpha,12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase) (3- hydroxyacyl-CoA dehydrogenase) (EC 11.1.35).
complexed with nad; swapped dimer with the extra C-terminal subdomains

Homo sapiens (9606)

 P51659 3-304

Derived from SCOP domain 124862
rasmol icon 1ZBQ A:3-304 X-RAY DIFFRACTION 2.19
Clustered domains rasmol icon 1ZBQ B:3-304 X-RAY DIFFRACTION 2.19
rasmol icon 1ZBQ C:3-304 X-RAY DIFFRACTION 2.19
rasmol icon 1ZBQ D:3-304 X-RAY DIFFRACTION 2.19
rasmol icon 1ZBQ E:3-304 X-RAY DIFFRACTION 2.19
rasmol icon 1ZBQ F:3-304 X-RAY DIFFRACTION 2.19