Representative Sequence

SPROT P55818

Bifunctional protein mdtA [Includes: NADP-dependent methylenetetrahydromethanopterin dehydrogenase (EC 15.1.-); Methylenetetrahydrofolate dehydrogenase (EC 15.1.5)]. (5929)

1
61
121
181
241
MSKKLLFQFDTDATPSVFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQS TAIFVGGGDMAAGERVFEAVKKRFFGPFRVSCMLDSNGSNTTAAAGVALVVKAAGGSVKG KKAVVLAGTGPVGMRSAALLAGEGAEVVLCGRKLDKAQAAADSVNKRFKVNVTAAETADD ASRAEAVKGAHFVFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKE YGGKRAFGALGIGGLKLKLHRACIAKLFESSEGVFDAEEIYKLAKEMA 60
120
180
240
288

Domains PDB ID RegionMethodResolution
Representative SP domain (8001043)
Bifunctional protein mdtA [Includes: NADP-dependent methylenetetrahydromethanopterin dehydrogenase (EC 15.1.-); Methylenetetrahydrofolate dehydrogenase (EC 15.1.5)].

Methylobacterium extorquens AM1 (272630)

 P55818 2-287

Derived from SCOP domain 78216
rasmol icon 1LUA A:2-287 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 1LU9 A:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 B:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 C:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA B:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA C:2-287 X-RAY DIFFRACTION 1.90
Representative PR domain (8001044)
Bifunctional protein mdtA [Includes: NADP-dependent methylenetetrahydromethanopterin dehydrogenase (EC 15.1.-); Methylenetetrahydrofolate dehydrogenase (EC 15.1.5)].

Methylobacterium extorquens AM1 (272630)

 P55818 2-287

Derived from SCOP domain 78216
rasmol icon 1LUA A:2-287 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 1LU9 A:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 B:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 C:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA B:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA C:2-287 X-RAY DIFFRACTION 1.90
Representative FA domain (8001045)
Bifunctional protein mdtA [Includes: NADP-dependent methylenetetrahydromethanopterin dehydrogenase (EC 15.1.-); Methylenetetrahydrofolate dehydrogenase (EC 15.1.5)].

Methylobacterium extorquens AM1 (272630)

 P55818 2-287

Derived from SCOP domain 78216
rasmol icon 1LUA A:2-287 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 1LU9 A:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 B:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 C:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA B:2-287 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA C:2-287 X-RAY DIFFRACTION 1.90
Representative SF domain (8001046)
Bifunctional protein mdtA [Includes: NADP-dependent methylenetetrahydromethanopterin dehydrogenase (EC 15.1.-); Methylenetetrahydrofolate dehydrogenase (EC 15.1.5)].

Methylobacterium extorquens AM1 (272630)

 P55818 2-271

Derived from SCOP domain 78216
rasmol icon 1LUA A:2-271 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 1LU9 A:2-271 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 B:2-271 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 C:2-271 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA B:2-271 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA C:2-271 X-RAY DIFFRACTION 1.90
Representative HF domain (8001047)
Bifunctional protein mdtA [Includes: NADP-dependent methylenetetrahydromethanopterin dehydrogenase (EC 15.1.-); Methylenetetrahydrofolate dehydrogenase (EC 15.1.5)].

Methylobacterium extorquens AM1 (272630)

 P55818 2-249

Derived from SCOP domain 78216
rasmol icon 1LUA A:2-249 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 1LU9 A:2-249 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 B:2-249 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 C:2-249 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA B:2-249 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA C:2-249 X-RAY DIFFRACTION 1.90
Representative CF domain (8001048)
Bifunctional protein mdtA [Includes: NADP-dependent methylenetetrahydromethanopterin dehydrogenase (EC 15.1.-); Methylenetetrahydrofolate dehydrogenase (EC 15.1.5)].

Methylobacterium extorquens AM1 (272630)

 P55818 2-97

Derived from SCOP domain 78217
rasmol icon 1LUA A:2-97 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 1LU9 A:2-97 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 B:2-97 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 C:2-97 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA B:2-97 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA C:2-97 X-RAY DIFFRACTION 1.90
Representative CF domain (8004340)
Bifunctional protein mdtA [Includes: NADP-dependent methylenetetrahydromethanopterin dehydrogenase (EC 15.1.-); Methylenetetrahydrofolate dehydrogenase (EC 15.1.5)].

Methylobacterium extorquens AM1 (272630)

 P55818 2-249

Derived from SCOP domain 78216
rasmol icon 1LUA A:2-249 X-RAY DIFFRACTION 1.90
Clustered domains rasmol icon 1LU9 A:2-249 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 B:2-249 X-RAY DIFFRACTION 1.90
rasmol icon 1LU9 C:2-249 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA B:2-249 X-RAY DIFFRACTION 1.90
rasmol icon 1LUA C:2-249 X-RAY DIFFRACTION 1.90