Representative Sequence

SPROT Q03131

Erythronolide synthase, modules 1 and 2 (EC 23.1.94) (ORF 1) (6- deoxyerythronolide B synthase I) (DEBS 1) (7008)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
1441
1501
1561
1621
1681
1741
1801
1861
1921
1981
2041
2101
2161
2221
2281
2341
2401
2461
2521
2581
2641
2701
2761
2821
2881
2941
3001
3061
3121
3181
3241
3301
3361
3421
3481
MSGPRSRTTSRRTPVRIGAVVVASSTSELLDGLAAVADGRPHASVVRGVARPSAPVVFVF PGQGAQWAGMAGELLGESRVFAAAMDACARAFEPVTDWTLAQVLDSPEQSRRVEVVQPAL FAVQTSLAALWRSFGVTPDAVVGHSIGELAAAHVCGAAGAADAARAAALWSREMIPLVGN GDMAAVALSADEIEPRIARWDDDVVLAGVNGPRSVLLTGSPEPVARRVQELSAEGVRAQV INVSMAAHSAQVDDIAEGMRSALAWFAPGGSEVPFYASLTGGAVDTRELVADYWRRSFRL PVRFDEAIRSALEVGPGTFVEASPHPVLAAALQQTLDAEGSSAAVVPTLQRGQGGMRRFL LAAAQAFTGGVAVDWTAAYDDVGPNPALCRSSRRPRRKTSRPSPASTGTRHRTCCERLLA VVNGETAALAGREADAEATFRELGLDSVLAAQLRAKVSAAIGREVNIALLYDHPTPRALA EALAAGTEVAQRETRARTNEAAPGEPVAVVAMACRLPGGVSTPEEFWELLSEGRDAVAGL PTDRGWDLDSLFHPDPTRSGTAHQRGGGFLTEATAFDPAFFGMSPREALAVDPQQRLMLE LSWEVLERAGIPPTSLQASPTGVFVGLIPQEYGPRLAEGGEGVEGYLMTGTTTSVASGRI AYTLGLEGPAISVDTACSSSLVAVHLACQSLRRGESSLAMAGGVTVMPTPGMLVDFSRMN SLAPDGRCKAFSAGANGFGMAEGAGMLLLERLSDARRNGHPVLAVLRGTAVNSDGASNGL SAPNGRAQVRVIQQALAESGLGPADIDAVEAHGTGTRLGDPIEARALFEAYGRDREQPLH LGSVKSNLGHTQAAAGVAGVIKMVLAMRAGTLPRTLHASERSKEIDWSSGAISLLDEPEP WPAGARPRRAGVSSFGISGTNAHAIIEEAPQVVEGERVEAGDVVAPWVLSASSAEGLRAQ AARLAAHLREHPGQDPRDIAYSLATGRAALPHRAAFAPVDESAALRVLDGLATGNADGAA VGTSRAQQRAVFVFPGQGWQWAGMAVDLLDTSPVFAAALRECADALEPHLDFEVIPFLRA EAARREQDAALSTERVDVVQPVMFAVMVSLASMWRAHGVEPAAVIGHSQGEIAAACVAGA LSLDDAARVVALRSRVIATMPGNKGMASIAAPAGEVRARIGDRVEIAAVNGPRSVVVAGD SDELDRLVASCTTECIRAKRLAVDYASHSSHVETIRDALHAELGEDFHPLPGFVPFFSTV TGRWTQPDELDAGYWYRNLRRTVRFADAVRALAEQGYRTFLEVSAHPILTAAIEEIGDGS GADLSAIHSLRRGDGSLADFGEALSRAFAAGVAVDWESVHLGTGARRVPLPTYPFQRERV WLEPKPVARRSTEVDEVSALRYRIEWRPTGAGEPARLDGTWLVAKYAGTADETSTAAREA LESAGARVRELVVDARCGRDELAERLRSVGEVAGVLSLLAVDEAEPEEAPLALASLADTL SLVQAMVSAELGCPLWTVTESAVATGPFERVRNAAHGALWGVGRVIALENPAVWGGLVDV PAGSVAELARHLAAVVSGGAGEDQLALRADGVYGRRWVRAAAPATDDEWKPTGTVLVTGG TGGVGGQIARWLARRGAPHLLLVSRSGPDADGAGELVAELEALGARTTVAACDVTDRESV RELLGGIGDDVPLSAVFHAAATLDDGTVDTLTGERIERASRAKVLGARNLHELTRELDLT AFVLFSSFASAFGAPGLGGYAPGNAYLDGLAQQRRSDGLPATAVAWGTWAGSGMAEGAVA DRFRRHGVIEMPPETACRALQNALDRAEVCPIVIDVRWDRFLLAYTAQRPTRLFDEIDDA RRAAPQAPAEPRVGALASLPAPEREEALFELVRSHAAAVLGHASAERVPADQAFAELGVD SLSALELRNRLGAATGVRLPTTTVFDHPDVRTLAAHLAAELGGATGAEQAAPATTAPVDE PIAIVGMACRLPGEVDSPERLWELITSGRDSAAEVPDDRGWVPDELMASDAAGTRAHGNF MAGAGDFDAAFFGISPREALAMDPQQRQALETTWEALESAGIPPETLRGSDTGVFVGMSH QGYATGRPRPEDGVDGYLLTGNTASVASGRIAYVLGLEGPALTVDTACSSSLVALHTACG SLRDGDCGLAVAGGVSVMAGPEVFTEFSRQGALSPDGRCKPFSDEADGFGLGEGSAFVVL QRLSDARREGRRVLGVVAGSAVNQDGASNGLSAPSGVAQQRVIRRAWARAGITGADVAVV EAHGTGTRLGDPVEASALLATYGKSRGSSGPVLLGSVKSNIGHAQAAAGVAGVIKVLLGL ERGVVPPMLCRGERSGLIDWSSGEIELADGVREWSPAADGVRRAGVSAFGVSGTNAHVII AEPPEPEPVPQPRRMLPATGVVPVVLSARTGAALRAQAGRLADHLAAHPGIAPADVSWTM ARARQHFEERAAVLAADTAEAVHRLRAVADGAVVPGVVTGSASDGGSVFVFPGQGAQWEG MARELLPVPVFAESIAECDAVLSEVAGFSVSEVLEPRPDAPSLERVDVVQPVLFAVMVSL ARLWRACGAVPSAVIGHSQGEIAAAVVAGALSLEDGMRVVARRSRAVRAVAGRGSMLSVR GGRSDVEKLLADDSWTGRLEVAAVNGPDAVVVAGDAQAAREFLEYCEGVGIRARAIPVDY ASHTAHVEPVRDELVQALAGITPRRAEVPFFSTLTGDFLDGTELDAGYWYRNLRHPVEFH SAVQALTDQGYATFIEVSPHPVLASSVQETLDDAESDAAVLGTLERDAGDADRFLTALAD AHTRGVAVDWEAVLGRAGLVDLPGYPFQGKRFWLLPDRTTPRDELDGWFYRVDWTEVPRS EPAALRGRWLVVVPEGHEEDGWTVEVRSALAEAGAEPEVTRGVGGLVGDCAGVVSLLALE GDGAVQTLVLVRELDAEGIDAPLWTVTFGAVDAGSPVARPDQAKLWGLGQVASLERGPRW TGLVDLPHMPDPELRGRLTAVLAGSEDQVAVRADAVRARRLSPAHVTATSEYAVPGGTIL VTGGTAGLGAEVARWLAGRGAEHLALVSRRGPDTEGVGDLTAELTRLGARVSVHACDVSS REPVRELVHGLIEQGDVVRGVVHAAGLPQQVAINDMDEAAFDEVVAAKAGGAVHLDELCS DAELFLLFSSGAGVWGSARQGAYAAGNAFLDAFARHRRGRGLPATSVAWGLWAAGGMTGD EEAVSFLRERGVRAMPVPRALAALDRVLASGETAVVVTDVDWPAFAESYTAARPRPLLDR IVTTAPSERAGEPETESLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPF KELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELGTEVRGEAPSALA GLDALEGALPEVPATEREELVQRLERMLAALRPVAQAADASGTGANPSGDDLGEAGVDEL LEALGRELDGD 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1080
1140
1200
1260
1320
1380
1440
1500
1560
1620
1680
1740
1800
1860
1920
1980
2040
2100
2160
2220
2280
2340
2400
2460
2520
2580
2640
2700
2760
2820
2880
2940
3000
3060
3120
3180
3240
3300
3360
3420
3480
3491

Domains PDB ID RegionMethodResolution
Representative FA domain (8000376)
Erythronolide synthase, modules 1 and 2 (EC 23.1.94) (ORF 1) (6- deoxyerythronolide B synthase I) (DEBS 1)
complexed with ndp

Saccharopolyspora erythraea (1836)

 Q03131 1395-1862

Derived from SCOP domain 133959
rasmol icon 2FR0 A:1448-1915 X-RAY DIFFRACTION 1.81
Clustered domains rasmol icon 2FR1 A:1448-1915 X-RAY DIFFRACTION 1.79
Representative SF domain (8000377)
Erythronolide synthase, modules 1 and 2 (EC 23.1.94) (ORF 1) (6- deoxyerythronolide B synthase I) (DEBS 1)
complexed with ndp

Saccharopolyspora erythraea (1836)

 Q03131 1604-1862

Derived from SCOP domain 133959
rasmol icon 2FR0 A:1657-1915 X-RAY DIFFRACTION 1.81
Clustered domains rasmol icon 2FR1 A:1657-1915 X-RAY DIFFRACTION 1.79
Representative IR domain (8000763)
Erythronolide synthase, modules 1 and 2 (EC 23.1.94) (ORF 1) (6- deoxyerythronolide B synthase I) (DEBS 1)
protein-representative domain; complexed with ndp

Saccharopolyspora erythraea (1836)

 Q03131 1590-1862

Derived from SCOP domain 133959
rasmol icon 2FR0 A:1643-1915 X-RAY DIFFRACTION 1.81
Clustered domains rasmol icon 2FR1 A:1643-1915 X-RAY DIFFRACTION 1.79
Representative IR domain (8001239)
Erythronolide synthase, modules 1 and 2 (EC 23.1.94) (ORF 1) (6- deoxyerythronolide B synthase I) (DEBS 1)
complexed with ndp

Saccharopolyspora erythraea (1836)

 Q03131 1395-1589

Derived from SCOP domain 133960
rasmol icon 2FR0 A:1448-1642 X-RAY DIFFRACTION 1.81
Clustered domains rasmol icon 2FR1 A:1448-1642 X-RAY DIFFRACTION 1.79
Representative HF domain (8001240)
Erythronolide synthase, modules 1 and 2 (EC 23.1.94) (ORF 1) (6- deoxyerythronolide B synthase I) (DEBS 1)
complexed with ndp

Saccharopolyspora erythraea (1836)

 Q03131 1612-1787

Derived from SCOP domain 133959
rasmol icon 2FR0 A:1665-1840 X-RAY DIFFRACTION 1.81
Clustered domains rasmol icon 2FR1 A:1665-1840 X-RAY DIFFRACTION 1.79
Representative CF domain (8004316)
Erythronolide synthase, modules 1 and 2 (EC 23.1.94) (ORF 1) (6- deoxyerythronolide B synthase I) (DEBS 1)
complexed with ndp

Saccharopolyspora erythraea (1836)

 Q03131 1612-1836

Derived from SCOP domain 133959
rasmol icon 2FR0 A:1665-1889 X-RAY DIFFRACTION 1.81
Clustered domains rasmol icon 2FR1 A:1665-1889 X-RAY DIFFRACTION 1.79
Representative CF domain (8004317)
Erythronolide synthase, modules 1 and 2 (EC 23.1.94) (ORF 1) (6- deoxyerythronolide B synthase I) (DEBS 1)
lacking strand 3; complexed with ndp

Saccharopolyspora erythraea (1836)

 Q03131 1418-1589

Derived from SCOP domain 133960
rasmol icon 2FR0 A:1471-1642 X-RAY DIFFRACTION 1.81
Clustered domains rasmol icon 2FR1 A:1471-1642 X-RAY DIFFRACTION 1.79