Representative Sequence

SPROT P00334

Alcohol dehydrogenase (EC 11.1.1). (753)

1
61
121
181
241
MSFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVT FYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAI LDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYT VNPGITRTTLVHKFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDL GTLEAIQWTKHWDSGI 60
120
180
240
256

Domains PDB ID RegionMethodResolution
Representative SP domain (8000297)
Alcohol dehydrogenase (EC 11.1.1).

Drosophila melanogaster (7227)

 P00334 2-256

Derived from SCOP domain 91264
rasmol icon 1MG5 A:1-255 X-RAY DIFFRACTION 1.63
Clustered domains rasmol icon 1MG5 B:1-255 X-RAY DIFFRACTION 1.63
Representative PR domain (8000718)
Alcohol dehydrogenase (EC 11.1.1).

Drosophila melanogaster (7227)

 P00334 2-256

Derived from SCOP domain 91264
rasmol icon 1MG5 A:1-255 X-RAY DIFFRACTION 1.63
Clustered domains rasmol icon 1MG5 B:1-255 X-RAY DIFFRACTION 1.63
Representative FA domain (8000794)
Alcohol dehydrogenase (EC 11.1.1).

Drosophila melanogaster (7227)

 P00334 2-256

Derived from SCOP domain 91264
rasmol icon 1MG5 A:1-255 X-RAY DIFFRACTION 1.63
Clustered domains rasmol icon 1MG5 B:1-255 X-RAY DIFFRACTION 1.63
Representative SF domain (8001233)
Alcohol dehydrogenase (EC 11.1.1).

Drosophila melanogaster (7227)

 P00334 2-241

Derived from SCOP domain 91264
rasmol icon 1MG5 A:1-240 X-RAY DIFFRACTION 1.63
Clustered domains rasmol icon 1MG5 B:1-240 X-RAY DIFFRACTION 1.63
Representative HF domain (8001234)
Alcohol dehydrogenase (EC 11.1.1).

Drosophila melanogaster (7227)

 P00334 2-185

Derived from SCOP domain 91264
rasmol icon 1MG5 A:1-184 X-RAY DIFFRACTION 1.63
Clustered domains rasmol icon 1MG5 B:1-184 X-RAY DIFFRACTION 1.63
Representative CF domain (8004314)
Alcohol dehydrogenase (EC 11.1.1).

Drosophila melanogaster (7227)

 P00334 7-241

Derived from SCOP domain 91264
rasmol icon 1MG5 A:6-240 X-RAY DIFFRACTION 1.63
Clustered domains rasmol icon 1MG5 B:6-240 X-RAY DIFFRACTION 1.63