Representative Sequence

SPROT P11938

DNA-binding protein RAP1 (9565)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
MSSPDDFETAPAEYVDALDPSMVVVDSGSAAVTAPSDSAAEVKANQNEENTGATAAETSE KVDQTEVEKKDDDDTTEVGVTTTTPSIADTAATANIASTSGASVTEPTTDDTAADEKKEQ VSGPPLSNMKFYLNRDADAHDSLNDIDQLARLIRANGGEVLDSKPRESKENVFIVSPYNH TNLPTVTPTYIKACCQSNSLLNMENYLVPYDNFREVVDSRLQEESHSNGVDNSNSNSDNK DSIRPKTEIISTNTNGATEDSTSEKVMVDAEQQARLQEQAQLLRQHVSSTASITSGGHND LVQIEQPQKDTSNNNNSNVNDEDNDLLTQDNNPQTADEGNASFQAQRSMISRGALPSHNK ASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYE VDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSL ITDEDTPTAIARRNMTMDPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENA WRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKRAR NYSSQRNVQPTANAASANAAAAAAAAASNSYAIPENELLDEDTMNFISSLKNDLSNISNS LPFEYPHEIAEAIRSDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKL HEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPP PNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEKDLL 60
120
180
240
300
360
420
480
540
600
660
720
780
827

Domains PDB ID RegionMethodResolution
Representative PR domain (8002439)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 360-594

Derived from SCOP domain 16049
rasmol icon 1IGN A:360-594 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:360-594 Some residues were not observed X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:360-594 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:360-594 X-RAY DIFFRACTION 2.99
Representative FA domain (8002440)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 446-594

Derived from SCOP domain 16049
rasmol icon 1IGN A:446-594 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:446-594 Some residues were not observed X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:446-594 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:446-594 X-RAY DIFFRACTION 2.99
Representative SF domain (8002441)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 449-553

Derived from SCOP domain 16049
rasmol icon 1IGN A:449-553 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:449-553 X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:449-553 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:449-553 X-RAY DIFFRACTION 2.99
Representative HF domain (8002442)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 449-553

Derived from SCOP domain 16049
rasmol icon 1IGN A:449-553 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:449-553 X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:449-553 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:449-553 X-RAY DIFFRACTION 2.99
Representative FA domain (8002443)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 363-416

Derived from SCOP domain 16048
rasmol icon 1IGN A:363-416 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:363-416 X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:363-416 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:363-416 X-RAY DIFFRACTION 2.99
Representative IR domain (8003978)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 387-409

Derived from SCOP domain 16048
rasmol icon 1IGN A:387-409 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:387-409 X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:387-409 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:387-409 X-RAY DIFFRACTION 2.99
Representative CF domain (8004210)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 449-553

Derived from SCOP domain 16049
rasmol icon 1IGN A:449-553 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:449-553 X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:449-553 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:449-553 X-RAY DIFFRACTION 2.99
Representative SF domain (8017605)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 363-416

Derived from SCOP domain 16048
rasmol icon 1IGN A:363-416 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:363-416 X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:363-416 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:363-416 X-RAY DIFFRACTION 2.99
Representative CF domain (8017606)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 363-416

Derived from SCOP domain 16048
rasmol icon 1IGN A:363-416 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:363-416 X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:363-416 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:363-416 X-RAY DIFFRACTION 2.99
Representative HF domain (8017607)
DNA-binding protein RAP1

Saccharomyces cerevisiae (4932)

 P11938 363-416

Derived from SCOP domain 16048
rasmol icon 1IGN A:363-416 X-RAY DIFFRACTION 2.250
Clustered domains rasmol icon 1IGN B:363-416 X-RAY DIFFRACTION 2.250

Saccharomyces cerevisiae S288c (559292)

rasmol icon 3UKG A:363-416 X-RAY DIFFRACTION 2.95

Saccharomyces cerevisiae S288c (559292)

rasmol icon 4GFB A:363-416 X-RAY DIFFRACTION 2.99