Representative Sequence

SPROT Q24368

Chromatin-remodeling complex ATPase chain Iswi (9582)

1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
MSKTDTAAVEATEENSNETTSDAATSSSGEKEAEFDNKIEADRSRRFDFLLKQTEIFTHF MTNSAKSPTKPKGRPKKIKDKDKEKDVADHRHRKTEQEEDEELLAEDSATKEIFRFDASP AYIKSGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPH IVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIR EKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLN FLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKI FVGLSKMQRDWYTKVLLKDIDVVNGAGKVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPY TTDTHLVYNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQ TPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDR AHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLN IIRFGANQVFSSKETDITDEDIDVILERGEAKTAEQKAALDSLGESSLRTFTMDTNGEAG TSSVYQFEGEDWREKQKLNALGNWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPP KQPIVQDFQFFPPRLFELLDQEIYYFRKTVGYKVPKNTELGSDATKVQREEQRKIDEAEP LTEEEIQEKENLLSQGFTAWTKRDFNQFIKANEKYGRDDIDNIAKDVEGKTPEEVIEYNA VFWERCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKGK NYTEIEDRFLVCMLHKLGFDKENVYEELRAAIRASPQFRFDWFIKSRTALELQRRCNTLI TLIERENIELEEKERAEKKKKAPKGSVSAGSGSASSNTPAPAPQPKASQKRKSEVVATSS NSKKKKK 60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1020
1027

Domains PDB ID RegionMethodResolution
Representative PR domain (8002280)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 697-978

Derived from SCOP domain 92827
rasmol icon 1OFC X:697-978 X-RAY DIFFRACTION 1.90
Representative FA domain (8002281)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 897-978

Derived from SCOP domain 92827
rasmol icon 1OFC X:897-978 X-RAY DIFFRACTION 1.90
Representative SF domain (8002282)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 902-978

Derived from SCOP domain 92827
rasmol icon 1OFC X:902-978 X-RAY DIFFRACTION 1.90
Representative HF domain (8002283)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 902-978

Derived from SCOP domain 92827
rasmol icon 1OFC X:902-978 X-RAY DIFFRACTION 1.90
Representative FA domain (8002284)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 799-850

Derived from SCOP domain 92826
rasmol icon 1OFC X:799-850 X-RAY DIFFRACTION 1.90
Representative FA domain (8002285)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 697-798

Derived from SCOP domain 92828
rasmol icon 1OFC X:697-798 X-RAY DIFFRACTION 1.90
Representative SF domain (8002286)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 697-798

Derived from SCOP domain 92828
rasmol icon 1OFC X:697-798 X-RAY DIFFRACTION 1.90
Representative CF domain (8002287)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 697-798

Derived from SCOP domain 92828
rasmol icon 1OFC X:697-798 X-RAY DIFFRACTION 1.90
Representative CF domain (8004201)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 902-978

Derived from SCOP domain 92827
rasmol icon 1OFC X:902-978 X-RAY DIFFRACTION 1.90
Representative SF domain (8017608)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 799-850

Derived from SCOP domain 92826
rasmol icon 1OFC X:799-850 X-RAY DIFFRACTION 1.90
Representative CF domain (8017609)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 799-850

Derived from SCOP domain 92826
rasmol icon 1OFC X:799-850 X-RAY DIFFRACTION 1.90
Representative HF domain (8017610)
Chromatin-remodeling complex ATPase chain Iswi
complexed with g4d, glc, gol

Drosophila melanogaster (7227)

 Q24368 799-850

Derived from SCOP domain 92826
rasmol icon 1OFC X:799-850 X-RAY DIFFRACTION 1.90