Representative Sequence

SPROT O08755

Hepatocyte nuclear factor 6 (9596)

1
61
121
181
241
301
361
421
MNAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVGHRGSHLPPAHPRSMGMASLLD GGSGGSDYHHHHRAPEHSLAGPLHPTMTMACETPPGMSMPTTYTTLTPLQPLPPISTVSD KFPHHHHHHHHHHHPHHHQRLAGNVSGSFTLMRDERGLASMNNLYTPYHKDVAGMGQSLS PLSGSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAG MVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEINTKEVAQR ITTELKRYSIPQAIFAQRVLCRSQGTLSDLLRNPKPWSKLKSGRETFRRMWKWLQEPEFQ RMSALRLAACKRKEQEHGKDRGNTPKKPRLVFTDVQRRTLHAIFKENKRPSKELQITISQ QLGLELSTVSNFFMNARRRSLDKWQDEGGSNSGSSSSSSSTCTKA 60
120
180
240
300
360
420
465

Domains PDB ID RegionMethodResolution
Representative PR domain (8002370)
Hepatocyte nuclear factor 6

Mus musculus (10090)

 O08755 291-437

Derived from SCOP domain 112044
rasmol icon 1S7E A:6-152 SOLUTION NMR n/a
Representative FA domain (8002371)
Hepatocyte nuclear factor 6

Mus musculus (10090)

 O08755 392-437

Derived from SCOP domain 112044
rasmol icon 1S7E A:107-152 SOLUTION NMR n/a
Representative FA domain (8002372)
Hepatocyte nuclear factor 6

Mus musculus (10090)

 O08755 291-370

Derived from SCOP domain 112045
rasmol icon 1S7E A:6-85 SOLUTION NMR n/a
Representative SF domain (8003749)
Hepatocyte nuclear factor 6

Mus musculus (10090)

 O08755 292-358

Derived from SCOP domain 112045
rasmol icon 1S7E A:7-73 SOLUTION NMR n/a
Representative CF domain (8003750)
Hepatocyte nuclear factor 6

Mus musculus (10090)

 O08755 292-358

Derived from SCOP domain 112045
rasmol icon 1S7E A:7-73 SOLUTION NMR n/a
Representative SF domain (8017614)
Hepatocyte nuclear factor 6

Mus musculus (10090)

 O08755 392-437

Derived from SCOP domain 112044
rasmol icon 1S7E A:107-152 SOLUTION NMR n/a
Representative CF domain (8017615)
Hepatocyte nuclear factor 6

Mus musculus (10090)

 O08755 392-437

Derived from SCOP domain 112044
rasmol icon 1S7E A:107-152 SOLUTION NMR n/a
Representative HF domain (8017616)
Hepatocyte nuclear factor 6

Mus musculus (10090)

 O08755 392-437

Derived from SCOP domain 112044
rasmol icon 1S7E A:107-152 SOLUTION NMR n/a